KEGG   Nasonia vitripennis (jewel wasp): 100116224Help
Entry
100116224         CDS       T01081                                 

Gene name
GstO1
Definition
(RefSeq) glutathione S-transferase O1
  KO
K00310  
pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Glutathione metabolism
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100116224 (GstO1)
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100116224 (GstO1)
Enzymes [BR:nvi01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     100116224 (GstO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
NASONIABASE: 
LinkDB All DBs
Position
5
AA seq 241 aa AA seqDB search
MSSAKHLTVGSKAPPVENGKLRLYSMRFCPYAQRIHLVLDAKKIPYDVVYVNLSQKPEWL
VEKSPLGKVPCLELENGDTLYESLVIAEYLDEAYPEHHLFPTDPLAKAKDKLLIERFNDV
ITSMYKLYSGKTVDKDLFNEALLGLEIFDRELAKRATPFFGGNQPGMLDLMIWPWCERAD
IIRILRGEQFVIPRERFLRLLEWKLAMKEDPAVKGSFLDAETHAKYMKSRQAGAPQYDLL
V
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtgcgaaacatctgacggtcggctcgaaggctccgcccgtagagaacggaaaa
ctccggctctacagcatgaggttctgcccttacgcgcagcgcatccacctcgtcctcgac
gccaagaaaataccttacgacgtagtctatgttaatctaagtcagaagccagagtggctg
gtggagaagagcccactgggcaaggtaccatgtctggaactggaaaatggagacacgctt
tacgagagcctagtcatagccgagtacttggatgaagcgtatcctgagcatcacttgttt
cccacggatccattagcaaaagcaaaagacaagttgcttattgaaagattcaatgatgtc
attacctctatgtacaaactatattcaggaaaaactgttgacaaagacttatttaacgaa
gcactcctaggattagagatctttgatagagaattagctaagagagcaacacccttcttt
ggaggtaatcaacctggcatgctagatttaatgatctggccatggtgcgagagggcagat
attataagaatcctcagaggggaacagtttgtcattccacgtgagagattccttagattg
ctggagtggaagctagccatgaaagaagacccagctgtgaagggcagttttttggatgct
gagacacatgcgaaatacatgaagagtcgtcaagctggtgctccacaatatgatctacta
gtataa

DBGET integrated database retrieval system