KEGG   Nasonia vitripennis (jewel wasp): 100116946Help
Entry
100116946         CDS       T01081                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Peroxisome
Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    100116946
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    100116946
Enzymes [BR:nvi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100116946
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
NASONIABASE: 
UniProt: 
LinkDB All DBs
Position
1
AA seq 150 aa AA seqDB search
MTKAVCVLQGDCKGTLFFEQDGDAVKVTGQVSGLKQGLHGFHIHEFGDNTNGCTSAGPHF
NPLAKEHGGPTDSVRHVGDLGNVEADSDGVAKVSITDKQIQLQGAHNIIGRTLVVHADPD
DLGKGGHELSKTTGNAGGRLACGVIGITKA
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaggccgtgtgcgttcttcagggcgactgcaagggaaccctgttcttcgagcaa
gacggcgatgcggtcaaggtcaccggccaagtgtccggcttgaaacagggactgcacgga
ttccacattcacgagtttggcgacaacaccaatggttgcaccagtgccggacctcacttc
aatcccctggctaaggagcacggaggcccaactgactctgttcgtcacgtaggcgacctg
ggtaatgttgaggctgactcagatggtgttgccaaagtcagcatcaccgacaaacagatt
cagctgcagggagcgcacaacatcattggcagaactcttgtggttcacgctgaccctgat
gacttgggaaaaggtggccatgaactctccaagaccactggcaatgcaggaggccgtttg
gcatgcggtgtaattggcatcacaaaggcatga

DBGET integrated database retrieval system