KEGG   Nasonia vitripennis (jewel wasp): 100121025Help
Entry
100121025         CDS       T01081                                 

Gene name
Setd1a
Definition
(RefSeq) histone-lysine N-methyltransferase SETD1A
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100121025 (Setd1a)
Enzymes [BR:nvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100121025 (Setd1a)
Chromosome and associated proteins [BR:nvi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100121025 (Setd1a)
   HMT complexes
    COMPASS/SET1 complex
     100121025 (Setd1a)
    COMPASS/SET1 complex (yeast)
     100121025 (Setd1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1
Motif
Other DBs
NCBI-GeneID: 100121025
NCBI-ProteinID: XP_016839395
NASONIABASE: NV15594
LinkDB All DBs
Position
3
AA seq 1768 aa AA seqDB search
MNGMERHGHGHGNSHSHHHRHHHHHHHPSHHHSDSGTGSSSHHHHSSHSNSSQNVSHNSN
SVAHQQHHHQPPQQQVVSKHNHGQPPPPQKDTSSGGSTASGPVALQKPRNYKLLVDPFLK
KGATKVYRYDGLVPGDPTYPAVQVRDPRSQLTRIWTRLDKMDLPVPRFKIDANYCGDPPP
LEVTFCHLNDNIDRTFLTDMVQKFGPTEELTIYYHPVTNKHLGIARVVFETTKASKACVE
KLNNTSVMGKVLRVFLDPFGDECRKLYEDLTVEKKVEKKVEKKVKEEPQTPAPVIPPTTS
IKNEVEQNKRGQTPLVSAEKTSTTATDERDSRHNKKSSHEKSRDSYVENSRFTSKMTPNF
RGDYPTPGGTSTSSNELGFSTPSELNYPSNFSQNSTPASNYDYFYGNYHHHHHHPPPHHH
TAANPAAANFIGGLPPPGVTQQQNLLNQANAGVWWPNAGAPETRGAVYPPNTSWPPPGII
PPDGALVPMTTVPGRNDLAVANSFKSAGSKKKDSDSPADSDSIHTPTKEQRRGESPSEQR
KTLDLDTRIAMLLKDKAGGMAPPFLQFGSDSEDERKSAADEEMLSNPPSPFLTNDLYEAC
FQKAQQRNRERRRVRENSLNQIPKSAGVDEDLGSIISSSEDEALLGSYSPTTAATGSKEP
EPPKEQPQPPPPPLDDDRMSLSPLSSGDEKIEEISHEPVNQHLFTYPNVAHLHHYPAGAG
VAAAAAAAAAATTNHHQQVYQPHHHQQPPPHPPPQGQQQWPRPAQYPFSYTIGATAAAAA
AYIPGQYGQPAPAVAATGLHGASVAGMPPLGPGTAGQNSGYYPNFQSRLQAMANHSITKD
NPQGATIQAVLNRVVNELKQILKKDFNKKMVENTAFKLFDVWWDDKKSEKGVPLAGTILS
STVNNAATPAAVATNDATAVTVTAATAPTNNAITAVATAAVAAAKEEPKNHLSQRASLLE
QATTPLGLNYEGFGLGIRASMPKMPSFRRKIKVPSPVAPQDEEDSRQSVEGRGAVENIVA
NAEAIDSDSDLDATLAPQKSATKRQIASLPSSSSSSSSSSTSSEDESSSSSSSSSSSDSS
SSSDSSDDEVADTFAKAKLARDSQDPEILAVLRSLTCKTPEDGPRTPIPKIDIFESAASY
DFPQIEDFEEEDEEMAYSDTTETKEIKQEEEINNANEMSAKRHASEWSDRAMVTPVTGVA
IKQETMPAIVPHDIKNMESSAIEALISLAGQDNKPPVTRVPSPVPIKPAPVGGNIIRKLQ
TMSDRYINDEPILKESEKIDMFSEIPTSESEEEESLEVRRQRCQAGLQQTAEARPRSQVC
RVYLEHSYSLLPSQQQEVLEQQKQVPSMQQPLVLTPSEVQPAKSTVVAQNLEKSDLKNLS
SSVNKERVEKKKNKHVKINNNAVLLEKSHEREKENIRIPPSSFERLVPPSSLSESLPPSH
HYATPTIYKERDLMSEMEILYEFLTRGIDHEDVEYLRRSYEALLADDTQSYWLNDTHWVD
HPATDIPSPAKRRKRDEVRLHVTGCARTEGYYKVDLKDKLKHKHHYAQSIQRNEDVREST
GSGGRVVGGLDSSSSLAINGPKVNSKALTGKMQALSREARSNQRRLLTAFGIDTDSDLLK
FNQLKFRKKQLKFAKSGIHDWGLFAMEPIAADEMVIEYVGQMIRPIVADLRETQYEATGI
GSSYLFRIDLDTIIDATKCGNLARFINHSCNPNCYAKVITIESQKKIVIYSKQPIGVNEE
ITYDYKFPLEDDKIPCLCGAPQCRGTLN
NT seq 5307 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcatggagagacatggacatggacacggcaattcgcactctcaccatcatcgt
caccaccatcatcaccaccatccatctcatcatcactcagacagtggcactggctcttcc
tcccatcatcaccactcgtcgcacagtaatagctcccaaaatgtctctcacaattccaac
tcggtggcccaccagcagcatcaccaccaaccccctcagcagcaggttgtgtccaagcac
aaccatggccagcccccgccgccgcaaaaagataccagcagcggcgggtcaacagctagt
gggcctgttgccctgcagaaacccagaaactacaagctgctggtcgatccatttttgaag
aaaggagccaccaaagtttataggtacgatgggcttgtaccaggtgatcccacgtatcct
gcagtccaggtcagggatccacgctcccagttaacccgaatatggacaaggttagacaag
atggatttacctgtgccaagattcaagattgacgctaattattgtggtgatcctcctccc
ttagaagtaacattttgccatttgaatgataatattgataggacttttcttactgatatg
gttcaaaagtttggaccaacggaagaactcacaatatattatcatcctgtcacaaataag
catcttggtatagcaagagttgtttttgaaactacaaaggcttctaaagcatgtgtagag
aaacttaataatacgtctgtaatgggtaaagtgctaagggtatttttggatccctttggc
gacgagtgtcgaaagctttatgaagatttaactgtagaaaagaaagttgaaaagaaagta
gagaaaaaagtcaaggaagagcctcagactccagccccagttattccacctacaacgtcg
attaagaatgaggtggaacaaaataagagagggcagacacctcttgtctcagcagaaaag
acttcaacgacagcaacggatgagagggacagcaggcataataaaaagtcaagccacgaa
aaaagtagagattcatatgtagaaaattctaggtttactagtaaaatgacccccaacttt
cgcggggattatccgacccccggcggtaccagtaccagtagcaatgagctgggctttagt
actcccagtgaactgaactatcccagcaatttctcccagaactcaacgccagccagtaac
tatgactacttttacgggaactaccatcaccatcaccatcatccacctccgcatcatcac
acagctgcaaatccagcagcagccaactttatcggaggcttgccacctccaggggttacc
cagcagcaaaaccttcttaaccaagcgaatgctggtgtttggtggcccaatgctggagca
cctgagactcgaggcgcggtgtacccaccaaatacttcctggccgccgccaggtattata
ccacctgatggcgccctggttcccatgaccacagtcccaggccgcaacgatctcgcagta
gctaacagtttcaaatcggccggttctaagaaaaaagactctgactctcccgcggattcg
gattccattcacacgccaacgaaggagcagcgccgaggtgaatcaccgtccgagcaacgc
aagaccctggaccttgatacccgaatagctatgctactgaaggataaggcgggtggtatg
gctccgccatttcttcagttcggtagcgacagcgaggacgaaagaaaatcggctgcagac
gaggagatgctgtctaatccacctagtcccttccttactaacgacctctacgaggcctgc
ttccagaaagcacagcagcgtaacagggaaaggcgcagagtacgcgagaacagcttgaat
cagataccaaagtcggcgggagttgacgaggatttgggaagtattattagttcgagtgag
gatgaggcactgttggggagctatagtccgacaacggcggcaaccgggtcaaaggagccc
gagccacccaaagaacagccccaaccaccacctccaccacttgatgatgatcgcatgtcc
cttagtcctcttagttccggtgatgaaaagatcgaagagatctcgcacgaacccgttaat
cagcaccttttcacttatccaaacgttgcacacctgcaccactacccggcgggagcaggt
gtagctgcagctgccgctgctgctgctgcagcgacgacgaatcaccatcagcaggtctat
caacctcatcatcaccagcagcctccaccgcatccaccgccacagggacaacaacaatgg
cccaggccagcacagtacccattttcttacaccattggagcgacggctgccgcggccgca
gcctatattcctggccaatatggtcaaccggctccggcagtggctgcaacaggattacac
ggagcatcggttgccggtatgccaccacttgggcctggaactgcaggtcagaattcggga
tattatcctaacttccagtccagactacaagcgatggccaatcatagtataactaaggat
aatccacagggcgctactattcaagccgtactgaatcgagtagtaaatgaactcaagcag
atcctcaagaaagacttcaacaagaagatggttgaaaatactgctttcaaactctttgat
gtctggtgggacgacaagaagtctgaaaaaggagtcccgctggccggtacaattttaagc
agcactgtcaacaatgcggcaaccccagccgcggtcgcgaccaacgatgcaacagcggtg
acggtaaccgcggccactgccccgacaaacaacgctataaccgctgttgctactgctgct
gttgctgctgctaaagaggagcctaaaaaccatctaagccaaagagcttctctgctcgag
caggcaacaacaccattgggtcttaactacgaaggttttggtctgggtataagggctagt
atgccgaaaatgccatcattcaggcgcaaaataaaagtaccaagtccggtggcgccgcaa
gatgaagaggacagccgacaatctgtagagggccggggtgctgttgaaaacatagttgct
aatgctgaagctatcgatagtgatagtgatttggatgcgacgcttgctccgcaaaagtct
gcaaccaagaggcagatcgcaagtcttcctagcagttcgtcatcctcttcctcctcgtct
acgtcatccgaggacgaaagtagttcgagcagtagcagcagcagtagcagcgattcgtcg
agttctagtgatagttctgatgatgaggtcgccgatacatttgcgaaagcgaaactggcc
cgcgatagtcaggatccggagatacttgcggttctgcggtcgttgacctgtaaaacacca
gaggatggcccgcgaacacctataccgaagatagacatattcgagagtgccgcatcgtat
gacttcccgcagatcgaagactttgaagaagaagatgaggaaatggcctactcagatact
actgaaaccaaagagatcaagcaagaggaggagatcaacaacgctaatgaaatgtctgcc
aagcgacatgcatcggaatggtctgatcgagcgatggtcacaccggtcacgggtgttgcg
ataaagcaagagacaatgccagctatcgtgccccacgacatcaagaacatggagagctct
gcaatcgaagctctgatatcactcgctggtcaagataacaaaccaccggtcacaagggtt
cccagtccagtgccgataaaaccggctccagtcggcggcaatattattagaaaactgcag
acgatgtctgataggtacataaacgatgagccgatcttgaaggaatccgaaaaaatcgat
atgtttagcgaaattccaactagcgaatctgaggaagaagagagcttagaggtcaggagg
cagagatgtcaagctggattacagcaaaccgcagaggcccgtcctaggtcgcaagtttgt
cgagtttatctagagcattcttactctctgcttccttcacagcagcaggaagtgctagaa
caacagaaacaagttccttcgatgcaacagcctctcgttcttacgccatcagaagtgcaa
cccgcaaaatcgactgtggttgctcaaaatctcgaaaaatctgacttgaagaatctgagc
agcagtgtaaataaggaacgcgtggagaagaaaaagaataaacatgtgaaaattaacaac
aacgcggtattactagaaaagagtcatgagcgcgagaaggagaatattcggataccaccg
tcgtcgtttgagagattggtgccgccgtcgtcgctgtccgagtcactgccaccctcgcat
cactatgccacgccaacgatttacaaagagcgtgatctcatgtccgaaatggaaatactc
tatgaattcctgacgcgaggcatcgaccacgaggatgtagagtacttacgcaggagttac
gaagccctacttgccgatgacactcagagttattggctcaacgatacgcattgggtcgat
catccagcgacagatatacctagtcctgctaaacggcggaagagagacgaggtgcggttg
cacgttactggctgcgcccgtacggagggttactacaaagtagacttgaaagacaaactg
aaacataagcatcactacgcgcaaagtattcaacgaaacgaggatgtacgagaaagcacc
ggtagtggtggtcgagtagtcggtggtctagatagcagtagtagtttagcgataaatgga
ccaaaggttaactcgaaagctcttaccggaaaaatgcaagcattgtcgcgagaagccagg
agcaatcaaaggcgcttattaacggcctttggcatagatactgatagcgatcttctcaaa
ttcaatcaacttaaattccggaaaaaacaattgaagtttgcgaaatccggaattcacgat
tggggactatttgccatggagcctattgcagccgacgagatggtgatagaatacgttggg
caaatgatcaggccaatagttgccgatctgcgtgaaacgcaatacgaagccacgggcatt
ggcagttcctatttattccgtatcgatttggacactataatcgacgcgaccaaatgtgga
aatctcgctcgattcatcaatcacagttgtaatccgaattgttacgccaaggttattacc
attgagagccagaaaaaaattgtgatttatagtaagcagccgattggagtcaacgaagaa
ataacgtatgactacaagttcccgctggaagacgacaaaatcccttgtttatgcggagca
cctcaatgtcgggggactcttaattaa

DBGET integrated database retrieval system