KEGG   Nasonia vitripennis (jewel wasp): 100121289Help
Entry
100121289         CDS       T01081                                 

Definition
(RefSeq) 4-aminobutyrate aminotransferase, mitochondrial
  KO
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100121289
   00650 Butanoate metabolism
    100121289
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100121289
   00280 Valine, leucine and isoleucine degradation
    100121289
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100121289
Enzymes [BR:nvi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     100121289
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     100121289
Amino acid related enzymes [BR:nvi01007]
 Aminotransferase (transaminase)
  Class III
   100121289
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
NASONIABASE: 
UniProt: 
LinkDB All DBs
Position
5
AA seq 490 aa AA seqDB search
MMVLKALPGLKALRGPLSRSLATQALADEPSAPQVTCEVPGPKSKELFRELNDMQQAGSV
QLFADYEKSAGNYLADVDGNMLLDVYMQISSMPLGYNHPAMLKALTDPHNQKMIANRPAL
GVFPNRDWPEKLKKVLLRKGVAPPGFSCITTMMCGSCSNENSFKNIFIWYADKHRHGEPF
TKEEMESCMINMVPGSPRYSIMSFDGAFHGRTLGSLSTTHSKYIHKIDVPAFDWPIAPFP
RYKYPLEANERENKEEDERCLARVDELFEIYAKEKKVPVAGVIVEPIQAEGGDNHGSPYF
FQKLQQITRKHGGALLIDEVQTGGGPTGKMWCHEHFNLDSPPHIVTFSKKMQMGGYYHLE
EMKPKQSYRVFNTWMGDPSKLILLEAIVDVIEKENLLDRVTRVGNYTLDHLKKLENEFPN
SINSSRGRGTFIAFDCATAQLRDATIKKLLQNGIQAGGCGEKAVRLRPALTFTEHHANIF
LDNLRSVLKG
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgatggtcctcaaagctctgccgggacttaaggcccttcgaggccctttgtcccggagt
ctggcgacccaggcgctggccgacgagccctcggcgccgcaggtcacctgcgaggtgccc
ggccccaagagcaaggaactcttccgcgagctcaacgacatgcagcaagccggctcggtc
cagctttttgccgattacgaaaaatcggccggcaattacctcgccgatgtcgatggtaat
atgctcttggatgtctacatgcagatatcatcgatgcccttgggctataaccatccggct
atgctgaaggcgcttaccgatccacataatcagaaaatgatcgcgaatcgaccggcactc
ggagtgttccccaaccgtgactggccggagaagttgaagaaagtcctgctccgaaaggga
gtagcaccgcctggattttcgtgcataacgacgatgatgtgcggctcgtgctcgaacgag
aactcgttcaaaaacatcttcatatggtacgcggataagcacaggcacggcgaacccttt
accaaagaagagatggagagctgcatgatcaacatggttcccggctcaccgcgttactcg
atcatgtcgttcgatggtgctttccatgggagaacgctcggttcgttgtcgacgacgcac
agtaaatatattcacaaaatcgacgtaccggctttcgactggccgatcgcgccgttcccg
cgttacaagtacccgctcgaagctaatgagcgcgaaaacaaggaagaggacgaacgctgt
ttggctagggttgacgagctgttcgaaatatacgcgaaggagaaaaaggttcctgtggca
ggagtgatagtcgagcctattcaagccgaaggtggcgacaaccatggctcgccctatttc
ttccaaaagcttcagcaaataactagaaaacacggaggcgccttgttgatcgacgaagta
caaaccggtggtggcccaaccggcaaaatgtggtgtcacgagcactttaatctcgattct
ccgccccacatcgtcactttcagtaagaaaatgcaaatgggaggctactatcatctcgaa
gaaatgaaaccaaagcagtcgtaccgcgtgttcaacacgtggatgggcgatcccagcaaa
ctgatacttttggaagctatcgtcgacgtcatagaaaaggagaatctgctggacagagtg
accagagtcgggaactacacgttagaccatttgaaaaaattagaaaacgagttcccgaac
tctatcaattcgtcacgcggtagaggaaccttcatcgctttcgactgtgccactgcccaa
ctcagggatgcgacgatcaagaagttgctgcagaatggcattcaagcgggaggctgcggt
gaaaaggctgttcgtttgagaccggctctcacgttcaccgagcaccacgccaacattttc
ctcgacaacctgcgctccgttctcaagggataa

DBGET integrated database retrieval system