KEGG   Nicrophorus vespilloides: 108557453Help
Entry
108557453         CDS       T04922                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: polyserase-2-like
  KO
K09640  
transmembrane protease serine 9 [EC:3.4.21.-]
Organism
nvl  Nicrophorus vespilloides
Brite
Enzymes [BR:nvl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     108557453
Peptidases [BR:nvl01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   108557453
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 1241 aa AA seqDB search
MFKLTLVSALVALAAASPMPPRLDGRIVGGETVVIEDFPYQLSLQYYGSHICGASIISKN
FAVTAAHCTNGSPASSLTVRAGSSIKGSGGQVVQVRNIFQNPQFDNRNIDYDISVLELSD
LLDFGACVQPVGLPRLNQEVPAGSDSVVSGWGALSEGGGSPSQLQAVHVGIISQKECKKS
YGDSAITDRMICAGVNGGGKDACQGDSGGPLVVDGQLVGVVSWGYGCARPASPGVYSSVP
NMRAYITEKAGISSPIIPRLDGRIVGGESVEIEDYPYQLSLQFYGSHICGASIISKYYAV
TAAHCTNGSPASTLAVRAGSSVKGSGGSXVYQNPKYNDYTVDYDISVLELSEPFNFGSGV
QPVDLPKLNQEVSAGSDSVVTGWGTLTVGGNSPIQLQAVHVDIVSHEDCVIAYGGAAITD
RMICAAVNGGGKDACQGDSGGPLVVDGQLVGIVSWGNECGRPTYPGVYSSVPNMREYITE
NAGILALVSAFLALAAGKCISYVIPALDDRIVGGEAVEIEDYPYQLSLQYFGSHICGATI
ISQNYAVTAAHCTDGSSASSLSIRAGSSYRGSGGQVVQVSKINQNPNYRKENLDYDISLL
TLSMSLNFEAGVQAVALPSLNQHVPVGTDCVVSGWGTLSEGGSSPLQLQAVHVKIVSVAS
CKSDYGSAAITDRMICAGVNNGGMDACQGDSGGPLVADGQLIGIVSWGYGCARPNYPGVY
ASVPNLLKFITDNAGNHKYVLPNTGRSTGPVSAFLALAAALDDRIVGGEAVEIEDYPYQL
SLQYFGSHICGASIISQNFAVTAAHCTDGLTASSLTIRAGSTYRGSGGQVVQVSAITQNP
NYNKENIDYDISVLRLSMPLNFGAGVQAVGLPSLNQQVPVDTDCIVSGWGAISEGGGSPS
QLQAVHVRIISVATCKSAYGSAAITDRMICAGYTNGGMDACQGDSGGPLVVDGQLIGVVS
WGYGCARPNYPGVYSSVPNLRNFITDRLKMFKLALVSALVALAAASPMTPRLDGRIVGGE
TVVIEDFPYQLSLQYYGSHICGASIVSKYFAVTAAHCTNGSPASSLSVRAGSSIRGSGGQ
VVQVKAVFQNPKFDSYNIDYDISVLELSDPLDFGAGAQPVGLPRLNQEVPAGSDSVVSGW
GALTEGGGSPSQLQAVHVGIISQEECKKAYGDSAITDRMICAGVNGGGKDACQGDSGGPL
VVNGQLVGVVSWGYGCARPTSPGVYSSVPNMRDYITENAGI
NT seq 3726 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagttaactttagtatcagcccttgtggctctcgcagctgcatccccgatgcct
ccacgcttggatggtcgcatcgttggtggtgaaaccgtcgtaatcgaagatttcccatac
caattgtctcttcaatactacggaagccacatctgcggtgcttccatcatcagcaagaac
ttcgccgtcaccgctgctcactgtaccaatggatccccagcttcctctttgaccgtccgc
gctggatcttccatcaagggatctggtggacaagttgtccaagttaggaatatcttccaa
aatccccaattcgacaaccgcaacatcgattacgatatctctgtcttggagctttccgat
ctattggactttggtgcttgtgttcaaccagtcggtttgccaagattgaaccaagaagtc
ccagctggctctgactccgttgtttccggatggggtgccctttccgaaggcggtggttct
ccttctcaacttcaagccgtccacgttggaatcatctcccagaaggaatgcaagaagtct
tacggagacagcgccatcaccgaccgcatgatctgcgccggagttaacggaggtggcaag
gacgcctgccaaggtgattctggtggcccactcgtcgtcgatggacaactcgttggtgtc
gtctcttggggatacggatgtgctcgtccagccagtccaggagtttactccagcgtacca
aacatgcgtgcctacatcaccgaaaaagccggcatctcatctccaataatcccacgtttg
gatggtcgcatcgttggaggtgaatctgtcgaaatcgaagactatccataccaattgtca
cttcaattctatggtagccacatctgtggtgcatcaataatcagcaagtactatgctgtg
actgcagctcactgcactaatggatctccagcttctacattggctgtccgcgctggatct
tccgtcaagggatccggtggaagcnncgtctatcaaaatccaaaatataatgactacacc
gttgattatgacatctctgtcttggaactgtctgaaccattcaactttggatcaggagtt
caacctgtagatttaccaaaattgaaccaggaagtctcagctggttcagactcagttgtt
actgggtggggtacccttaccgtaggtggaaattctcctatccaactccaagccgttcat
gttgacattgtttcacacgaagattgcgtaatagcttacggtggcgctgccatcaccgac
cgcatgatttgcgctgcagttaatggaggaggcaaggacgcttgtcaaggtgattctggt
ggtccactggttgttgatggacaacttgttggtatcgtttcctggggaaacgaatgtggg
cgtcccacttatccaggtgtctactccagcgttccaaatatgcgtgaatacattacagaa
aatgcaggaatcttggctttagtctcagccttcttggctctcgctgctggtaagtgtatt
tcttacgttatcccagctttggatgatcggattgttggtggtgaagccgttgaaatcgaa
gattacccctaccaattgtctcttcaatacttcggaagccacatatgcggtgctactatc
atcagccagaactacgctgttactgctgctcactgcactgacggatcgtcagcttcctcg
cttagcatacgcgctggatcttcctacaggggatcaggaggacaagttgtccaggttagc
aaaattaatcaaaaccccaattataggaaagaaaacttagattacgacatatctctcttg
acgctctccatgtcattgaactttgaagctggtgttcaagcagttgcattgccaagcttg
aaccaacatgtcccagttggcactgactgcgttgtttctggatggggtaccctttcagaa
ggtggcagctctcccttgcaactacaagctgttcatgttaaaattgtctccgtggcttca
tgcaagagtgattatggtagcgccgccatcaccgaccgcatgatctgcgctggagttaac
aacggtggcatggacgcctgccaaggtgattctggtggtccacttgtcgccgatggacaa
ctcattggtattgtttcctggggatacggttgtgcccgtccaaattatcctggagtttat
gccagcgttccaaatttgctcaaatttatcactgataatgcggggaatcacaagtatgtt
ttacccaatacaggacgcagcaccggtcctgtctcagccttcttggctctcgctgctgct
ttggatgatcggattgttggtggtgaagccgttgaaatcgaagattacccctaccaattg
tctcttcaatactttggaagccacatatgtggtgcttccatcatcagccagaacttcgca
gttactgctgctcactgcaccgacggattgacagcttcctcattgaccatacgcgctgga
tctacctacaggggatcaggaggacaagttgtccaggttagcgccattactcaaaacccc
aattataacaaagaaaacatagattacgacatctctgtcttgaggctctccatgccattg
aactttggagctggtgttcaagcagttggattgccaagcttgaaccaacaagtcccagtt
gacactgactgcattgtttctggatggggtgccatttcagaaggtggcggctcaccttct
caactacaagctgttcacgttagaattatctccgtggcgacatgcaagagtgcttatggt
agcgcggccatcaccgaccgcatgatctgcgctggatatactaacggaggcatggatgcc
tgccaaggtgattctggtggtccacttgtcgtcgatggacaactcattggtgttgtttcc
tggggatacggttgtgcccgtccaaattatcctggagtttattccagcgttccaaatttg
cgcaattttatcactgatagactcaaaatgttcaagttggctttagtttcagccctcgtg
gctctcgcagctgcatctccaatgaccccacgtttggatggtcgcatcgttggtggtgaa
accgttgtaatcgaagatttcccataccaattgtctcttcaatactacggaagccacatc
tgtggtgcttccattgtcagcaagtacttcgccgtcaccgctgctcactgcaccaatgga
tccccagcttcctccttgagcgtccgcgctggatcttccatcaggggatccggtggacaa
gttgtccaagttaaggccgtcttccaaaatcctaaattcgacagctacaacattgattac
gatatctccgtcttggagctttccgatccattggactttggagctggtgctcaaccagtc
ggtttgccaagattgaaccaagaagtcccagctggctctgactccgttgtttccggatgg
ggtgcccttaccgaaggtggcggctctccttcccaacttcaagccgtccacgttggaatc
atctcccaggaggaatgcaagaaggcatacggagacagcgccatcaccgaccgcatgatc
tgcgccggagttaacggaggtggcaaggacgcctgccaaggtgattctggtggcccactc
gtcgtcaatggacaactcgttggtgttgtctcctggggatacggatgcgcccgtccaacc
agcccaggagtttactccagcgttccaaacatgcgtgactacatcaccgaaaatgccgga
atctaa

DBGET integrated database retrieval system