KEGG   Nicrophorus vespilloides: 108558701Help
Entry
108558701         CDS       T04922                                 

Definition
(RefSeq) histone deacetylase 4
  KO
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
nvl  Nicrophorus vespilloides
Brite
Enzymes [BR:nvl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     108558701
Chromosome [BR:nvl03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     108558701
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 796 aa AA seqDB search
MAEQREAPERLLEQQILQLKKQHQLQHQILLQHFQQQQQHLAEQHEQQLRQHLKEFWDQQ
KQLQDIRQREQLEALRKKEKHEESAIASTEVKQKLQSFLRQRASGCSKTNLNQNQENSWS
EGMDTSSDQSHANDFPLRKTASEPNLLKVRLKQRVMERRSSPMSKRHLPPSLKKKILSCQ
PPSESPPQEPPKELSPPCESDEYQRHALFSSPSMPNISLAAHHLSTTEVSEAAMRAACTA
RLGMSLTGQMLPGSLPFYPSLPAIESEHEEASTLDTISELQEPTPRGVIRPLGRTQSSPL
PLRHPLLDGNHKPAQQPAPPLPEEQEQRDMELRTNESRSIRPLSRASSSPVVHLAAAALL
QRRRASSTPTTGLAFDNQMLKHACVCGNNSQHPEHAGRLQSIWARLLETGLVHRCDRIRP
RRASTQELQTCHSEAHTLLYGTSSLNRHKIDMSKMSALPVPAFVRLTCGGIGVDSDTTWS
ELYTAPAARMAVGCTVDLAFRTWTGDIRNGFAIVRPPGHHAEPQQAMGFCFFNSVAIAAR
LLQKEHRVHKILIFDWDVHHGNGTQDIFYDDPRVLVISMHRHDDGNFFPGTGNPVECGSG
AGIGFNVNVAWSGGLNPPLGDSEYLAAFRSVVMPIAREFSPDIVLVSAGFDAADGHAPPL
GGYRVSPACFGYMTRQLMQLARGRVVLALEGGYDLPSICDSAEECVRVLLGDPPSSMQPA
ELARAPCQNAVIALQNVIAIQSRHWPCLHEGAKGVICSHNDVVRNEKDDKDTVSAMASLS
MQQSLGYPSPDAARPS
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atggcagagcagcgagaggcacccgagagactgctggagcagcagatcctgcagctcaag
aagcagcaccagttgcagcaccagatacttttgcagcacttccaacagcagcagcagcat
ctggccgaacagcacgagcagcagcttcggcagcatctgaaagagttctgggaccagcag
aagcagctgcaggacatcaggcagcgagagcaactggaggcgctaagaaagaaggagaag
cacgaggagagcgctatcgcgtccaccgaagtaaagcagaaactgcagtctttcctgcgg
cagagagcttcgggatgttccaaaacaaatctcaatcagaatcaggaaaattcctggtct
gaaggtatggacacaagttcagatcaatctcacgccaacgactttccattaaggaaaaca
gcgtccgagccaaatctcttaaaagtacgattgaaacagcgagtaatggagcgtcgctct
agtccaatgagtaaacgtcacctgcctccaagtttgaagaagaaaattttgtcatgtcag
ccgccgagtgaatcacccccacaagaacctcctaaagagttgagtcctccttgtgaatct
gatgaatatcagagacacgctttgttcagtagtccatcgatgcctaacatttcgttggcg
gctcaccacctttccactaccgaagtatcggaagcggccatgagggcagcatgcacggcc
cggttaggaatgtcgttaactggacagatgctgccgggctcgttgccattctacccatca
ttgccggccatcgaaagtgaacatgaagaagcatcgacattggatactatcagcgaactg
caagaaccaacaccccgcggtgttattaggcctttgggtaggacgcaatctagtccgtta
ccattgaggcatccgctgctcgatggaaatcataaacccgcccaacaacctgcgccacct
ctgcccgaggaacaggaacaacgtgatatggaacttagaaccaacgaatcaagaagtatt
cgtcctttatcgagggcttctagtagtccggtggtacatttggcagctgcagctctgctg
caaagacgccgagcttcctcaacgccaacaacgggcttggcctttgacaaccaaatgctc
aaacacgcttgtgtgtgtggtaacaattctcagcatccagaacacgccggtcgactccag
agcatatgggcgaggttattggaaacaggattggtacaccggtgcgacaggattcggcct
aggagggcgtcgacgcaagaacttcagacgtgtcattcggaagctcataccttgctgtac
ggcacaagttcgttgaataggcacaaaattgatatgagcaaaatgagtgcacttcctgtg
ccggctttcgtgcggttaacgtgtggtggcattggagtggattccgatacgacatggagc
gagttgtatacggcaccagcagctcgtatggcagtgggatgcaccgtggatttggctttc
aggacttggaccggagatatacgcaacggatttgcaattgtaagaccgcctggtcatcac
gctgaacctcaacaggcaatgggtttctgcttcttcaattctgtcgctattgctgcgaga
ttgttgcagaaagaacatcgcgttcataaaatactcatcttcgattgggacgtgcaccat
ggaaatggaactcaggatatattttacgatgacccaagagtattggtaatttcaatgcac
agacacgatgacggcaacttctttccaggaacgggcaatcccgtcgaatgcggatcggga
gcgggtatcggttttaatgtgaatgtggcgtggtcgggcggtttgaatccgccgttaggg
gactccgagtatttggccgctttccggagtgttgtgatgccaattgcaagggaattttct
ccggacattgtacttgtttctgctggattcgatgctgctgatggacatgcaccaccatta
ggcggttatcgagtttcacctgcttgttttggatatatgacacgtcagttgatgcagtta
gcacgtggacgagtggtgctcgccttggagggtggctacgacttgccttcaatatgtgat
tcggcggaggaatgtgttcgagtgttgttgggcgatcctccgtcttctatgcagcctgcc
gaacttgctcgtgcaccctgccagaacgctgttattgccctacaaaatgttatagcgatt
caatctaggcattggccttgccttcacgaaggggctaagggagtgatatgctcccacaac
gacgtagttagaaatgagaaggatgacaaagacactgtttcggcgatggcctcgttgtca
atgcaacagtcgcttgggtatccaagtccggacgctgcaagacctagctaa

DBGET integrated database retrieval system