KEGG   Nicrophorus vespilloides: 108560889Help
Entry
108560889         CDS       T04922                                 

Definition
(RefSeq) histone-lysine N-methyltransferase E(z) isoform X1
  KO
K11430  
histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
nvl  Nicrophorus vespilloides
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:nvl00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    108560889
Enzymes [BR:nvl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     108560889
Chromosome [BR:nvl03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108560889
   Polycomb group proteins
    PRC2-EZH2 complex
     108560889
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 753 aa AA seqDB search
MSKQKVSAEWKKRVKQEYMRLRQIKRYKRADEVKIQWNLNQNRVCQVLITEQKRWTESKS
FWVNTPEFPSHVTCMKKAEVIGNEGDIQVIPIKIINSVTPIPTMYTWAPIQQNFMVEDET
VLHNIPYMGDEILDQDGTFIEELIKNYDGKVHGDRESGFIDDQLFVELVHALMQYQDKKD
QPEKKEKKVEAEKPKEETETKEDGEKAVEAKETSEEVKMEVKKEELEFPSNMIFQAISSQ
FPDKGQPEELREKYIELTERMDPNALPPECTPNIDGPTAESVPREQTLHSFHTLFCRRCF
KYDCFLHRNQGLQACHPGPNLQKRRGPDLKPFTEPCGPDCYMLLDGVKEKLAAKAKQDEQ
DENDKGKDKNSKDNTSQNSRANQNPRKVCKEQSVDSGNEASSEDSNDSNKFNKDDGNTDV
STTTAFSLLGLMGKDDHCEWTGSDQSLFRALIKVFLNNFCAIAQIMLTKTCQQVYQFAQK
EAADIPTEDSFKDYTPPRKKKKKHRLWSVHCRKIQLKKDSSSNHVYNFTPCDHPGQSCDA
HCPCIGAQNFCEKFCQCSSDCQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCQTCGADQ
FDLSKITCKNVSVQRAQHKHLLMAPSDVAGWGIFLKDSAQKNEFISEYCGEIISQDEADR
RGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSINPNCYAKVMMVNGDHRIGIFAK
RAIQPGEELFFDYRYGPTEQLKFVGIEREMEFL
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagcaaaaggtgtctgcggaatggaaaaagcgcgtaaagcaagaatatatgcga
ctgaggcaaatcaaaaggtacaaaagggctgacgaggtgaagattcaatggaacctgaac
cagaatcgagtgtgccaagttctgattacagagcagaaacgatggacggaaagcaaatcg
ttttgggtgaataccccagaatttccatcacatgtaacatgtatgaaaaaggctgaagta
attggcaatgaaggagacatacaagttattccaattaaaattataaattctgtaacacca
attcctaccatgtatacctgggctccaatccaacaaaacttcatggttgaggatgagact
gtccttcacaacattccatatatgggagatgaaattttggatcaagatggcacttttatc
gaggaactgattaaaaattatgatggaaaagtacatggtgatagggaatctggattcatt
gatgatcaactatttgttgaattagtgcatgcactgatgcaataccaagataaaaaggac
caacctgaaaagaaggagaaaaaggtagaagcagagaaaccaaaagaagagactgaaaca
aaagaagatggtgaaaaggctgttgaggccaaggagacttctgaggaagttaagatggag
gttaaaaaggaggaattggagtttcctagtaacatgatatttcaagcaatatcatcacag
tttcctgacaaagggcaaccagaagaattgagggaaaaatatatagaattaactgagaga
atggatccaaatgcactgccaccagaatgcaccccaaacattgatgggcccacagctgaa
tctgtacctagagaacaaacattacattcatttcacactttattttgcagaaggtgtttt
aaatatgattgctttttacatagaaaccaaggacttcaagcttgtcatccaggtccaaat
ctgcagaaacgtcgaggtccagatttgaaaccgttcacggagccgtgcggccctgattgc
tacatgctgttggatggtgtcaaggaaaagttggccgcaaaagcgaagcaagacgagcaa
gatgaaaacgataaaggtaaagataagaattcaaaagacaatacgtctcaaaatagtcgc
gcgaatcaaaatcctaggaaggtttgtaaagaacaatccgtagattctggaaacgaggca
agttccgaagacagcaatgattcaaataaattcaataaagatgatgggaataccgatgtt
tcgacaaccacggcgttcagtttgctgggcttgatgggaaaggatgatcattgcgaatgg
accggttctgatcaaagtttgttccgtgctttgatcaaagtgtttctaaacaatttttgt
gccattgcgcaaatcatgcttacaaaaacatgccagcaggtgtatcaatttgcccagaag
gaagcggctgatattcccaccgaagactcgttcaaagactacactccgcccagaaagaag
aagaagaagcatcgtctttggtcggtgcattgccgcaaaattcaattgaaaaaggattcg
agcagcaatcacgtttataattttactccgtgcgatcatcccggacaaagctgcgatgct
cattgtccatgcattggtgctcaaaacttctgcgagaagttttgccaatgtagttcagac
tgtcaaaatcggttcccgggatgcagatgcaaagcgcaatgcaacaccaagcaatgtcct
tgttacttggctgttcgagaatgtgatccggacttatgtcaaacttgtggagcggatcag
tttgatctcagcaagattacttgcaaaaatgttagcgtgcagcgtgctcaacataaacat
ttattgatggcaccatctgacgtagcaggctggggaatctttctgaaggatagtgcccag
aaaaatgagtttatttctgaatattgcggagagattatttcgcaggatgaggccgaccgc
agagggaaagtttatgacaagtacatgtgcagttttctatttaaccttaataacgatttc
gtggtcgatgcaacaagaaaaggaaataaaatccgatttgctaatcattcgatcaatcca
aattgctacgccaaggtgatgatggtgaatggggatcataggattgggattttcgcgaag
cgagcaatccagcctggtgaagaactgttctttgactacagatatggccctacggagcag
ctcaaatttgtaggcatagagcgagagatggaattcctttga

DBGET integrated database retrieval system