KEGG   Nicrophorus vespilloides: 108563044Help
Entry
108563044         CDS       T04922                                 

Definition
(RefSeq) 4-aminobutyrate aminotransferase, mitochondrial
  KO
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
nvl  Nicrophorus vespilloides
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:nvl00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    108563044
   00650 Butanoate metabolism
    108563044
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    108563044
   00280 Valine, leucine and isoleucine degradation
    108563044
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    108563044
Enzymes [BR:nvl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     108563044
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     108563044
Amino acid related enzymes [BR:nvl01007]
 Aminotransferase (transaminase)
  Class III
   108563044
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 490 aa AA seqDB search
MLSKAVKPSVIKNIINKGAVRTVTSLVPGEPNGPSVKTEIPGPRSKELIKELSAIQQSNA
VQFFADYEKSLGNYIVDADGNVMLDAYTQISSMPLGYNHPNLLKVFNNDKNMRTLINRPA
LGVFPGEDWPKKLKDVLLAVSPNLPNVTTMMCGSCSNENAYKNLFIAYRRNERGENVSFT
EEENASCMINQAPGAPKLSILSFHGAFHGRTLGVLATTHSKAIHKLDIPSFDWPIAHFPQ
YKYPLADNVRENAEEDKKCLAEVEDLIVTYKKKGIPVAGIVIEPIQSEGGDNEASPEFFQ
QLQRIAKKHGAGLLIDEVQTGGGPTGKMWCHEHFNLETPPDIVTFSKKMQIGGYFHNLEM
QPATPYRIFNTWMGDPGKMLIVEEILKVVKQQNLLDVVNKTGLKLKSGLEQLQNEFPALL
NSVRGRGTFLAMNAANTKLRDDLVNRMKQKGIQSGGCGEISIRLRPALIFQEHHADIFLD
TFRQVLKETK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcgaaagcggtgaaaccgtcggtcatcaagaacatcatcaacaagggtgctgta
aggactgtgaccagtttggtgccaggagaacctaatggacccagcgtgaaaaccgagatt
cccggacccaggtcgaaggaactcatcaaagagctgagcgctattcagcaatccaacgcc
gttcaattcttcgccgattatgaaaagtctttgggaaattacatcgtcgatgctgatggc
aatgttatgctggatgcgtacacccaaatctcatccatgcctttgggttacaaccaccca
aatcttctgaaggttttcaataacgacaagaatatgcgcactttgattaatcgcccagcg
cttggcgtattcccaggagaagattggcccaagaaattgaaggacgttttacttgccgtt
tctccaaacttaccgaacgtcaccacgatgatgtgtggatcttgttccaacgagaacgcc
tacaagaacttgttcattgcttaccgccgcaacgaacgtggagaaaacgttagcttcacc
gaagaggaaaacgcctcgtgcatgatcaatcaagctccaggtgcaccaaagttgtccatt
ctctccttccacggcgccttccatggtagaactttgggagtgttagccaccacccactcg
aaagccatccataagctcgacattcccagtttcgactggcccatcgcccatttcccgcag
tacaagtatcctctggcggacaacgttagagagaacgctgaagaggataagaaatgttta
gccgaagtcgaagatctgatcgtaacttacaagaagaagggaatcccagtcgctggtatc
gtcatcgaacccatccaatccgaaggtggcgacaacgaagcctctcctgagttcttccaa
caactacaaagaatcgccaagaagcacggagccggtcttctgatcgatgaagttcaaaca
ggcggtggacccaccggaaagatgtggtgccacgagcacttcaatctggaaactcctcca
gatatcgtcaccttcagcaagaagatgcaaatcggtggatacttccacaacctggaaatg
caaccggcgactccgtacaggatcttcaatacttggatgggagatccaggaaagatgttg
atcgttgaggagatcctcaaagtcgtcaagcagcaaaacctcttggacgttgtaaacaag
accggattgaagttgaagagtggtttggagcagctccagaatgaattccccgctcttctt
aactccgtcagaggacgcggtacattcttggccatgaacgcggccaacacaaagctcaga
gatgatcttgtgaacaggatgaagcagaagggtatccaaagcggcggatgcggagaaatc
tctattcgtttgaggccagccctcatcttccaagagcatcatgccgacatcttcttggac
accttcagacaagtcttgaaagaaacaaagtaa

DBGET integrated database retrieval system