KEGG   Nicrophorus vespilloides: 108564562Help
Entry
108564562         CDS       T04922                                 

Definition
(RefSeq) annulin-like
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
nvl  Nicrophorus vespilloides
Brite
Enzymes [BR:nvl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     108564562
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 751 aa AA seqDB search
MGRRRWYHCGGWFPCYPFRRRHAALRFENLPKPKEADITDGVPYIDSEKESDILIVRKID
PCIAINGALHHTSKYELMSREFEPSLVVRRGQSFKLDIDLSRPYNEDTDGISFIFTVQDE
DKPSHGQGTLIALPLMKFPDKSLSWSVVLENSFQNSITVLVTPSPKCIVAKWKLDIDTKI
INDGSYSYSWSLPIYIICNPWLSEDQVYMSSEEWRTETVLENVGLIWRGTSNRLRPCIWN
YGQFEKDILDCSLYLVKYIGKLSAMSRSDPVSMVRALSAAVNSVDDDGAIEGNWSNDYEG
GTAPTKWVGSMEILQKFYKKKKPVKYGQCWVFSGVLTTICRSLGIPARTVTNYSSAHDTQ
SSLTVDYFMNEKGEVMEELNSDSIWNFHVWNEVWMDRPDLGEDYGGWQAIDATPQEMSDD
MYKCGPSSVNAVKRGEILRPYDASFLFAEVNADKVYWRYEGPNQPLKLLRKDPHSIGKLI
STKAPGKFEREDITHTYKYEETTEEERAIMLKALKQSSSSFSRYYLNEEFNDIYFQFHMK
DDIKIGEPFDVSLFAKNKSSVNDYNINVLLRVEVVTYRGKIGDAVKTEHFNVSLKKNSSQ
EMKLQVTYEEYFKRLLDQAAFNISCLARVDGTEYEYYAQDDFRVRKPDVKIQLKDDPVED
TPCKASAYLVNPLPIPLRKGEFKIEGPGIDEVFKVKDNVRSNEKVLVDFTFTPRKHGKHT
IAAKFTSKELDDCDGYLNFWVNFKKELENEV
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgggaagaagaaggtggtatcattgcggtggttggtttccctgctatccctttcgacga
agacacgcagcgttgaggtttgaaaatttgccgaaacctaaggaagcagatatcacagat
ggcgtaccttatatagactcagagaaagaaagcgacattctaattgtgaggaaaatcgat
ccgtgtatcgcgataaatggcgccttgcaccatacatccaaatacgaactgatgagcagg
gaatttgaacctagcttagtcgtcaggcgaggacaatcatttaaactagacattgatctt
agtagaccttacaatgaagacacggacggcatttcctttatattcacagttcaagatgaa
gataaaccttcacacggacaaggaactttaattgctctaccacttatgaaatttccggat
aaatctctatcctggagcgtcgttttagaaaactcttttcaaaatagcattacagttctt
gtaactccatcaccaaaatgtatagtcgctaaatggaagttagatatagacacaaagatt
attaatgatgggtcatacagttattcgtggtcattaccgatctacatcatttgtaatcca
tggttgtcagaggatcaagtttatatgagctctgaggagtggagaactgagactgtgctt
gaaaacgtcggattaatttggaggggtacctcgaatagacttagaccctgcatatggaat
tacggacaatttgagaaagacattttagattgttccttatatttagtaaagtatataggt
aaactcagcgccatgtccagatccgacccagtcagcatggttagagctttatccgcagca
gtaaactcggtggatgatgacggagcaattgaaggaaattggtccaacgattacgaagga
ggaactgcaccaacgaaatgggttggaagcatggaaatcctgcagaaattttacaagaaa
aagaagcctgtaaaatacggccaatgctgggttttctcaggagttcttactacaatttgt
agatctctcggaataccagccagaaccgttacgaattactcgtccgcacatgacacacaa
agctctctaaccgtagattatttcatgaatgagaaaggcgaagtcatggaagaactcaat
tccgattccatatggaatttccacgtatggaacgaagtttggatggataggcctgacttg
ggcgaagactacggtggttggcaagctatagacgcaactccacaagaaatgagtgatgat
atgtacaaatgcggtccatcgtcagtgaacgccgttaaacgaggagaaatattgcgccca
tacgatgccagtttcttatttgcagaagtcaatgccgataaagtttattggcgatacgaa
gggccgaatcagccgttaaaacttctccgaaaagatcctcattcaattggcaaattgata
agcaccaaagcaccaggaaagtttgaaagagaagatatcactcacacttacaaatatgag
gaaactaccgaagaagaacgtgcgattatgttgaaagctttgaagcaatcctctagttct
ttctctcggtattacttaaacgaggaattcaacgatatttacttccaattccacatgaaa
gatgatattaaaatcggagaaccatttgatgtctcgctattcgcgaagaacaaaagttct
gtaaacgactacaatatcaatgttctattgcgagtagaagttgtgacatatagaggcaaa
attggtgatgccgtcaagacggaacatttcaatgtttccttaaagaaaaattctagtcaa
gagatgaaacttcaagtgacgtacgaagaatatttcaagagattgttggatcaagccgca
ttcaatatttcgtgtttggctagggtcgatggaaccgaatacgagtattacgcgcaggat
gattttcgcgtgagaaaacctgacgtgaaaatccaattaaaggacgatccagtggaagat
acaccgtgcaaagcatctgcatacttggtaaatccattacccataccattgaggaaaggt
gaatttaaaatcgaaggacctggtatcgacgaagtattcaaagtaaaagacaacgtgaga
agcaatgaaaaagttctagtcgatttcacatttacgccaagaaaacatggaaagcataca
attgcagccaaattcacatcgaaagaattagatgactgtgatggttatctaaatttctgg
gttaatttcaaaaaggaattagaaaatgaagtttaa

DBGET integrated database retrieval system