KEGG   Nicrophorus vespilloides: 108569124Help
Entry
108569124         CDS       T04922                                 

Definition
(RefSeq) probable histone-lysine N-methyltransferase CG1716
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
nvl  Nicrophorus vespilloides
Pathway
nvl00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:nvl00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    108569124
Enzymes [BR:nvl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     108569124
Chromosome [BR:nvl03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108569124
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW
Motif
Other DBs
NCBI-GeneID: 108569124
NCBI-ProteinID: XP_017786038
LinkDB All DBs
Position
Unknown
AA seq 1884 aa AA seqDB search
MGPKKRKAAKQPQALSSDQEDAPKTTTTAAAAASTRKTRSQGKLIKREVPQLLPVKGVKK
MPAVKPKPRLTKRIGKFRGLNEVSTEEVAVASADAEELSSSSTPSTESLEPPVETMEIKD
VECEELSEAQEVQEQPEAINSDDIESEVILGCIEEDFYVQQEEIIAEEDSNTVTKIEDTQ
EYQDKIEANKTDEMEHIQIRNDEIQEEMIENSENLDVMEVETCKDIIMGSSEESIPGDKE
ESIPQDDKVIVETVSSEDSSTMTSNSEEITTSEESVNDDNKREEIVETVDGDAAEQQDLK
HETVASEEDSNFTSELSDNEAQIASAKNDDEVKNVEEVNEETEIQVTTVEDAVENSDVSE
TTDILKTASDVSSEDSEVKSSSVSSNTDDSESKLEEKSSEEEVITSDVKDDNVIDSEVKD
DEVEGMGDGKGEISLETISKSIEEMEDDKEVEVVSKEMVELKIETEDKPKVILPSRKSKR
ISLKRDKLKAASTDVKAKEVAKEDEQDEVKVEMKTEEEKPAEEAEVKTEIKEEVLTETDT
SEKSDEPKVDPPKIAIKKKLKKEQETKQTDNNNVKKKRVVKVSPKQTAASRQSKKNEELA
NEAIRRSSRIKTISSQKKSARGKGLVKKESNNTDNSDNSNSGNAEYEKSSRDSPALVAPT
KSIVDSKPVKVKSRWRRTSELEMNTSRSSSSLGESSVVNAQSGNKKMEVDEEVERRLKQF
VHLKENQYLTERISCKEAKKMTCDCFLTQDEIQQGEFGCGEDCLNRLLMIECGNLCTVND
RCTNKRFQKGQSAPCEVFRTEKKGLGIRAAANIPYGEFILEYVGEVLDPEEFEDRAADYS
KDKNRHYYFMSLRADAVIDATQKGNISRFINHSCDPNAETQKWTVGGELRIGFFSTRTIL
AGEEVTFDYQFQRYGKEAQKCFCEATNCRGWLGEEPDDDEEEEEDEEDEEEEEGVVEKVI
ELDSEKVKEIVSEEVAPENIKEEEKAEEKTLEVTEIPVQKEKSPKKEKKAKVKKITRKDI
FEDLALDDEIASLQTTGLKNQAHTLKLSRLMVRAKESNQRAKLLAILKAGDMPCRRLFLD
YHGLRLMHGWMTDAQQLASEDNDMEYMRLETLQTLSTLPIPNKTMLQDSKVLSLVEKWSV
SEKPAESSEDSESNSPQLEQEPVPEVVPEKREEPVENDDEEEIRRSVGMDFVNRPTYKEF
DFKNIADELINIFDDAAEASPIAFEEKEAGNKPNIIADILALASKLLETWANLKEVFRIP
KKERIEQMKEHERQADKRYKAMAFEQVENQEKRGRENRYSRSNYRPSNRFGDCDRNRKNE
RIPSTGNSVCSTGHNSYPRISKHERRKLFAMQVEQQAEEERRRKQRESWRQHEKHCMMMG
TDPRFTAPYDPNRGYQCIWNPQIGQWQNYALSSDQHVLFNQMPNSNFPFVPRPQNMSVPP
PQKMHSIPPPQVHGMPHVMPNIHSLPPTAINHPMPSGIPAALVPPIVAPPTMAEASMGSM
PPMPNIPPMPTLPYHDKVEDPSQVTFMGPIPPPAKLPAKWKCAKDKYGRPYYYHVKIRKS
QWEPPELPPEEVEYYSESTSSSDTSSLSSDSSSEDTDSDDIDDEQLMLEIRSKFSRMEAQ
KKLLKSRGGDPDDLEHGLAEAHDSIMPDDLDESSLQDDDRTEDKSSLDRRIEELGILRDT
PPVKKRRIGLVQEIIISPRTEEDSKQFKENIKKYKQNKEKLRKQKEMIMQQSKKVMATLP
PSTSSTTSLSTPPSTPSSASSGVKPKKKLAVKTKLKEMDNNNEASRKIKEIFRSNMAGVM
VGILNAYRKLDCKQGRITNTDDFKHLARKLTHFVMLKELKHCQKIEDLTCTESVKAKAKE
FVRKYMSKFGEQYIRPPDDLDNYG
NT seq 5655 nt NT seq  +upstreamnt  +downstreamnt
atggggcccaagaagaggaaagccgccaagcagccccaagctctatcatcggatcaggag
gatgcgccgaagacaacaacaacagcagcagcagcagcatcgacgaggaagaccaggtct
cagggaaagcttattaagagagaagtgccccaattgctgccagtgaaaggagtgaaaaag
atgcctgcagtgaaacccaagccccgattaacaaagaggattggcaagtttcgtggcctg
aatgaagtgagcactgaggaggttgcagttgcttctgcagatgcagaggagcttagtagc
agcagcaccccaagcactgagagccttgagcctcccgttgaaaccatggaaattaaagat
gttgaatgtgaagaattaagtgaagcacaagaggtgcaggagcagccagaggcgatcaat
tctgatgatattgagtctgaggttattctgggctgcatcgaggaagatttttatgtgcaa
caggaggaaattattgctgaagaggactcaaacacagtcactaaaattgaagatacacag
gaatatcaagataaaattgaagcaaataaaacagatgaaatggagcatatccaaatacgc
aatgatgaaattcaagaggaaatgattgaaaattcagagaatttagatgttatggaagta
gaaacttgtaaggatataattatgggaagctctgaagaaagtattccaggtgataaagaa
gaaagtatacctcaagatgataaagtaatagtggaaactgtaagcagtgaagatagtagc
accatgactagtaatagcgaagaaataacgacgagcgaggaatccgtgaacgatgataac
aaacgggaagagatcgtagaaactgtagacggagatgcggcagaacagcaagatttaaaa
catgagactgttgcgagcgaggaagactctaatttcactagcgaattatcagataacgag
gctcagattgcaagcgcgaaaaacgatgatgaagttaaaaacgtggaggaagtaaacgaa
gaaacagaaattcaggtgacgacagtggaagatgcggtggaaaattccgatgtttcggaa
acgactgatattttaaaaactgcttctgacgtgtccagcgaagattcagaggtgaagagt
agctcggtctcatcgaatacggacgacagcgaatcgaaattggaggagaaaagtagtgag
gaagaggtgatcaccagcgatgttaaagacgacaatgtgattgatagcgaagttaaagac
gacgaggttgagggtatgggtgatggtaaaggggaaataagtttggagacgattagtaag
agcatagaggagatggaagacgataaggaggtggaggtggtgtccaaggagatggtagag
ttgaagatcgaaactgaggataaacccaaggtgattttgccgagtcggaagagtaagagg
atttcgttgaagcgagataagttgaaggcggccagcacggatgtgaaggcgaaggaggtg
gctaaagaagatgagcaggatgaagtcaaggtggagatgaaaactgaagaggagaagcct
gcagaagaagcggaggtgaaaactgagataaaggaggaggttttgacggaaacggacacg
tcggagaagagcgacgagcccaaggtggatccgccgaagatcgcgatcaaaaagaaactg
aagaaggagcaagaaacgaagcagactgataacaataacgtaaagaaaaagagggtggtg
aaggtttcaccgaagcaaacagcagcttcgcggcagagcaagaagaacgaggagctggcg
aacgaagccatccgcagatcgagtcgcatcaagacgataagcagccaaaagaagtctgcg
agaggaaagggtttggtgaagaaggaatcgaataacacggataattcggataacagcaac
tcgggaaatgcggagtacgagaagtcttcgagggattcaccggctttggtcgcgcccacg
aagagtatcgtcgactcgaaaccggtgaaggtcaaatcgcgctggagacggaccagcgaa
ttggaaatgaacacgagcagaagctcctcttcgttgggtgaaagtagcgtggtgaatgcc
caaagtggaaacaagaagatggaagtcgacgaagaggtggaacgacgcttgaagcagttc
gtgcatctcaaggagaatcagtatctgacggaaaggatcagctgcaaggaggccaagaaa
atgacatgcgactgtttcctcacgcaggatgaaatccaacagggtgagttcggctgtgga
gaggattgcctgaatcgattactcatgattgaatgcggaaatctatgcacggtgaacgac
aggtgcacgaacaagaggttccagaagggacagagcgccccgtgcgaagtattcaggacg
gagaagaaaggtcttggcattcgagctgctgcaaacatcccttatggagaatttattttg
gaatatgttggcgaagttttggatccggaggagtttgaggatagggcagccgactattcc
aaggataaaaatagacattactacttcatgtctttaagagctgacgctgttatagatgca
acacaaaagggtaacatttcgcgattcataaaccactcgtgcgacccgaacgccgagacc
caaaaatggactgtgggaggtgaactcaggatcggatttttcagcactcgaacaatttta
gccggtgaagaagtcacattcgattaccaatttcagagatacggaaaagaagcgcagaag
tgtttttgcgaggcaacgaactgcagagggtggctaggggaagagcctgatgatgatgaa
gaagaagaagaggacgaggaggatgaagaggaagaggagggagtcgtcgagaaggtcatt
gagttggattcggagaaggtcaaggagatcgtcagcgaagaggtagcgccggagaatatt
aaggaagaggagaaggccgaggagaagactctggaagtaacggaaattccggtacagaag
gagaaatcgccgaagaaggagaagaaagcgaaggtgaagaagatcacgcgaaaggacatc
ttcgaggatcttgctctggacgatgaaatagcgtcgctgcagacgaccgggctaaagaat
caagcgcatacgttgaagctgagcaggttgatggtgcgcgccaaggagagtaatcaaagg
gcgaaattgctagcgatcctcaaagccggggatatgccctgcaggagactcttcttggac
taccacgggttgcgtttgatgcatggctggatgacggacgcccagcagttggccagcgag
gataacgatatggaatacatgcgcctggaaacgcttcagacgttatccacgctgcccata
cccaataagacgatgcttcaggattcgaaggtgctatcgctcgtggagaagtggtcggtt
tctgaaaagccggctgaatcttcagaagattccgaaagcaattcaccgcagttggagcag
gagccggtgcccgaggtggtgccggagaagagagaggaaccggtggagaacgacgacgag
gaggagatcaggagatccgtaggaatggactttgtgaatcgacccacgtacaaggagttc
gatttcaagaatatagcagatgaactgatcaatatcttcgatgatgctgcggaggcttct
ccgattgctttcgaagagaaggaagctggtaacaaaccgaacataattgcggatattttg
gctctcgcttcgaagttattggagacctgggccaatttgaaggaggtgttcaggatccct
aagaaggagcggatagaacagatgaaggagcacgagaggcaggcggataaaagatataag
gcgatggcctttgagcaagtggagaatcaggaaaagaggggcagggagaacagatattcg
aggtccaattatcgtccgtccaacagattcggggattgcgacagaaaccgcaagaatgag
aggataccttcaactggtaatagcgtttgctcgaccggtcataattcttatccgaggata
agcaagcacgagagaagaaaactgtttgctatgcaggtggagcagcaggcggaggaggag
agacgcagaaagcagagggagtcgtggaggcaacacgagaagcactgcatgatgatgggc
acggatcctaggttcacggcaccctacgatccgaatcgtggttaccagtgtatatggaat
ccgcagatcggacagtggcaaaactacgctctgtcctccgatcagcacgtcctcttcaat
cagatgcccaattcgaattttcccttcgtgcctagacctcagaacatgtcggtgcctcca
ccgcagaagatgcattctataccgccaccgcaagtgcacgggatgccgcacgtcatgccc
aacatccatagtcttccaccaaccgcaatcaatcatccaatgccgagcggaattccggcc
gccctcgttccgcccatcgtggctccacctacgatggccgaggcaagtatgggttcgatg
ccgcccatgcccaatataccgccaatgccaacgcttccatatcacgacaaagtcgaggac
ccgtcgcaggtgacgttcatgggtcccataccaccgcccgccaaactaccagcaaagtgg
aaatgcgccaaggacaaatacggcagaccgtactattaccacgtcaagattaggaaatcg
caatgggagccaccggaattaccacctgaagaagtcgaatattattcagagtcgacgtcg
agttcggacacgagcagtctgagctcggattcgagttcggaggatacggacagcgatgac
atcgatgatgaacaactcatgttggagatccgcagcaagttcagcaggatggaagcgcag
aagaagctgttgaagtcacgcggcggagatcccgatgacctggagcacggcctggcggag
gcgcacgacagtattatgcccgatgatctggacgagtccagtctgcaggacgatgacaga
actgaggacaaatcgtctttggatcggaggatagaagagttgggcattctcagggatacg
cctccagtcaagaagcgcaggatagggttggttcaggaaataattattagcccaagaact
gaggaggacagtaaacagtttaaggagaatatcaaaaagtacaagcaaaataaggagaag
ctgcggaagcagaaggaaatgatcatgcagcaaagcaagaaggtgatggccacgttgcct
ccgagcacgtcctccacgaccagtctgtcgacgcctccttccacgccctcctcggcatca
agcggcgtcaaaccgaagaagaagttggcggtgaagacgaagctgaaagagatggacaac
aataacgaggcgagtcgcaagatcaaggagatcttcaggtcgaatatggccggagtgatg
gtcggtatcttgaacgcgtataggaaattagactgcaagcaaggacgaatcacgaatacc
gatgacttcaagcatttggccagaaagttaacgcatttcgtgatgctgaaagagctgaag
cactgccaaaagatcgaggatctgacgtgcacggaaagcgtgaaggcgaaagccaaggag
tttgtgcgtaagtacatgtccaagttcggcgaacagtacatacgtccgccggacgactta
gataattacggttga

DBGET integrated database retrieval system