KEGG   Nitrosococcus watsonii: Nwat_1143Help
Entry
Nwat_1143         CDS       T01266                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa00010  Glycolysis / Gluconeogenesis
nwa00020  Citrate cycle (TCA cycle)
nwa00620  Pyruvate metabolism
nwa01100  Metabolic pathways
nwa01110  Biosynthesis of secondary metabolites
nwa01120  Microbial metabolism in diverse environments
nwa01130  Biosynthesis of antibiotics
nwa01200  Carbon metabolism
Module
nwa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nwat_1143
   00020 Citrate cycle (TCA cycle)
    Nwat_1143
   00620 Pyruvate metabolism
    Nwat_1143
Enzymes [BR:nwa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Nwat_1143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N HlyD_3 NQRA HlyD_D23
Motif
Other DBs
NCBI-ProteinID: ADJ28077
JGI: Nwat_1143
UniProt: D8K5A0
LinkDB All DBs
Position
1214956..1216305
Genome map
AA seq 449 aa AA seqDB search
MVREFKLPELGENVESGDVAKVLVSPGDTLEKDQPVLELETDKAVVEIPSTVSGKIKELK
VEIGDQVAIGQVILTLEEGEEDIQEEAPAAKEEAKPEQDDKPSEKNAAVTGGQQPAPKVS
RMEAREERGIKRDEITAAPETTVSAPAPATPSVRRLARELGVDIHEVTGSGPGGRISGDD
VKHYVRALVSQRTTPSSAPGVVSQATPFLPLPAFEKWGAVEREPMSKIRRKTAEQMSQAW
TIPHVTQHDQADITRLEQARKRLARRVEQAGGKLTLTAIALKVVAAALRAFPRFNTSIDV
DAKELVYKQYCHIGVAVDAEHGLLVPVLREVDQKNIAQLAVELTELAEKARSRKIGPEEM
AGGSFTITNLGGLGGSYFTPIINWPEVAILGLSRAKLTPLYREGELQPRLLLPLSLSYDH
RVIDGADAVRFLRWIAEALEDPLLLSLEG
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtggtgcgtgaatttaagcttcccgaattaggcgagaatgttgaatctggtgatgtggcc
aaagtgctggtatctccaggagatactttagaaaaggatcaaccggttttagaacttgaa
accgacaaggcggtagtggaaatcccttcaacagttagcggtaagatcaaggagttaaag
gttgaaataggagatcaagtggccattggccaagttattcttaccttggaagaaggggaa
gaggacatccaagaggaggctcctgctgctaaagaagaggcaaagcctgagcaggatgac
aaaccctctgaaaaaaacgcagccgtaacaggtggccagcagccagcacctaaagtctct
cgaatggaggctcgcgaggagagggggataaagagggatgagatcacagccgcccctgaa
acaacggtttcggcgcctgctccagcgaccccatcagtgcggcgattagctcgggagctc
ggcgttgatattcacgaggtcacagggtctggcccgggtgggcggatttccggggatgat
gtgaagcattatgtccgtgctttggtatcccagcggaccacgccatcatcagctcccgga
gttgtttctcaagcgactcccttccttcccctgccagcgtttgaaaaatggggtgcggtg
gagcgggagcccatgagcaagatacgccgcaagacggcggagcaaatgagccaagcctgg
actattccccatgtgacccagcatgatcaggcggatattacccggcttgagcaagcccgg
aagcgtcttgctaggcgggtagagcaagcaggcggcaaactcaccctgaccgctattgcc
ttgaaggtagttgctgccgcactgcgagctttcccccgctttaatacatccatagatgtg
gacgctaaagagctggtctataaacagtattgtcatatcggcgtggcggtggatgcggag
catggcctgctggtacccgtccttcgggaggtcgatcaaaaaaatatcgcgcagctagcg
gtagagctaacagagcttgccgagaaggcgagaagccgaaaaatcggtcccgaggaaatg
gccggaggttcttttaccattaccaacctgggtggtttaggcggctcctattttaccccc
attattaattggccggaggttgctattttgggtctctcccgagctaagttgactcccctt
tatagagaaggagaacttcagccccggctgcttctgcccctttctctgtcttatgaccat
cgggtcattgatggcgccgatgcggttcgttttttgcgctggattgcggaagcgttggaa
gatcccctcttgctgtccttggaggggtag

DBGET integrated database retrieval system