KEGG   Nitrobacter winogradskyi: Nwi_0353Help
Entry
Nwi_0353          CDS       T00276                                 

Definition
(GenBank) ATP-dependent DNA ligase LigD polymerase module / ATP-dependent DNA ligase LigD phosphoesterase module
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
nwi  Nitrobacter winogradskyi
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:nwi00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Nwi_0353
Enzymes [BR:nwi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Nwi_0353
DNA repair and recombination proteins [BR:nwi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Nwi_0353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(394743..397484)
Genome map
AA seq 913 aa AA seqDB search
MPSRKLSTYRNKRDFSKTAEPSGGARIAPARQRRFVIQKHDATRLHYDFRLEYDGVFKSW
AVTRGPSLDPAVKRLAVEVEDHPLDYGDFEGTIPKGQYGGGTVAIWDRGYWYADDPAKGL
AKGDLKFALMGEKLRGEWVLVRMKNDRSGGKRTNWLLIKHRDDYARPGDGEDVLKQDRSV
ASNRTLEQIAEGKGKAPEPFMMTRRIAGSDAVWDSNKGVAARARARAERRPAKASAQPAS
TGKTTLKESRPQTARAHAIKSKMPDFAGLQLCEAATRPPSADSWVHEIKLDGYRIQMRIE
SGAVTLRTRKGLDWTDRFPAIAKAAAKLPDALIDGEIVALNANGDPDFPAMQAALAEGRT
DALVYFAFDLLFTEGEDLRPLPLLARKDQLRKLLGRSAKSNRATIRYVEHFDVDGEQMLA
TARESGLEGIISKRIDAAYRAGRRGSWLKTKSRPGHEVVIGGWKTTGDKFRSLMAGVHNG
DRLVYTGIVGTGYGRDTVKRIMPALKAAAASKSPFSGKNAPAGGRDVHWLKPELVAEIEF
AGWTDDGMVRQAAFKGLRADKPAREVTAEMPTRAAALKLDKARPKATRPGTRAAAAARSD
PTTSRQSRTSAARDRSTVMGVAISHPDKALWPDAGDKRPVTKHDLAAYMEAVGGWMIGHI
RGRPCSIVRAPDGIHSETFFQRHAMPGLSDLVTQAKVSDDRKPYLQIDRVEALAAVAQIG
GIELHPWNCAPDEYTVPGRLVFDLDPAPDVAFPDVIAAAREMRQRLEALKLESFCKTTGG
KGLHVVTPLAIGPKDGLNWKQAKMFAQAVCEQMAADAPDKYLINMSKKQREGKIFLDYLR
NDTKSTAVAPLSPRARPGATVSMPLNWAQVKTGLDPKRFTLRTAPDLLKKSKAWADYDSA
ARPLAAAIGRLVR
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
gtgccctcgcgaaaactgagcacctatcgcaacaagcgtgacttctcaaaaaccgccgag
cccagcggcggggcgcgcatcgcgcccgcaaggcagcggcgattcgtgattcagaagcac
gacgccacccgactgcattacgacttccgccttgagtatgatggggtcttcaaatcctgg
gcggtgacgcgcggtccctcgctcgatccggccgtgaagcggctggccgtcgaggtcgag
gatcatccgctcgactacggcgacttcgaaggcaccattccgaaaggccagtatggcggc
ggcaccgtggcgatctgggatcgcggctactggtacgccgacgatccggccaagggcctc
gccaagggcgacctcaaattcgcgctgatgggcgagaagctcagaggcgaatgggtgctg
gtgcgcatgaagaacgaccgcagcggcggaaagcgcaccaactggctgctgatcaagcac
cgcgacgattacgccaggccgggtgacggcgaggatgtgctgaaacaggatcgttcggtt
gcatcgaaccggacccttgaacagatcgccgaaggcaagggcaaggcgccggagcctttc
atgatgacccggcggatcgcgggttcggatgcggtttgggattcgaacaagggagtcgca
gcaagagcgcgcgccagggcagagaggcggccggcaaaggcgagcgcacaacccgcttca
accggcaagacgacgctgaaggaaagcagaccacaaaccgccagggctcacgcgatcaaa
agcaagatgccggacttcgcgggacttcagctttgcgaagcggcaacgcgcccgccgtcg
gcggatagctgggtgcatgagatcaaactcgacggctatcgcatccagatgcggatcgag
agcggcgcggtcacgctcagaacccgcaagggacttgactggaccgacaggtttccagcc
atcgcgaaggcggccgcgaagttgccggacgccctcatcgacggcgagatcgtcgcgctg
aacgccaatggcgatccggatttcccggcgatgcaggccgcgctggccgaaggcaggacg
gatgcgctggtgtacttcgcgttcgacctgctgtttacggaaggtgaggatctacgcccg
ctgccgctgctggcgcgcaaggaccagcttcgcaaattgctgggacgctctgcgaaatcg
aaccgcgcaacgatccgctatgtggagcatttcgacgtggacggcgaacagatgctggca
acggcgcgcgagtccggcctcgagggcatcatctccaaacgcatcgacgcggcctatcgc
gccggccgccgcggcagttggctcaagaccaagagccgccccggccatgaggtcgtgatc
ggcggctggaaaacaacaggcgacaaattccgctcgctgatggccggcgtccataacggc
gaccgcctcgtctataccggcatcgtcggcaccggctacggccgcgacaccgtgaaacgc
atcatgccggcgctgaaggcggcggccgcatcgaaaagtccgttctccggcaagaacgcg
ccggccggcggccgcgacgtccattggctgaagcccgaactcgtcgccgagatcgaattc
gccggctggaccgatgacggcatggtccggcaagccgccttcaagggactgcgcgcggac
aagccggcgcgcgaggtcacggcggagatgccgacccgtgcggcggccttaaagctcgac
aaggcgaggccgaaggccacacggcccggcacgagagccgccgccgccgcacgctctgac
ccgacgacatcgcggcagtctcgcacgtctgcggcgcgcgatcgctcgacggtgatgggc
gttgcgatctcgcatccggataaagcgctgtggccagacgcaggcgacaagcggccggtc
accaagcacgatcttgccgcctacatggaggccgtgggcggctggatgatcggccacatc
cgcggacggccgtgttcgatcgtgcgcgcgccggacggcatccacagtgagaccttcttc
cagcgccacgccatgccgggcctgtctgatctggtcacgcaggcgaaggtgtcagacgac
cggaagccttatctgcagatcgaccgcgtcgaggcgctggcggcggtggcgcagatcggc
ggcatcgaactgcatccgtggaattgcgcgccagacgaatatacggtgcctgggcggctg
gtcttcgacctcgaccccgcgccggatgtcgcatttcccgacgtgatcgccgcagcgagg
gaaatgaggcagcggctggaggcgctcaagctcgaaagcttctgcaagaccaccggcggc
aagggcctgcacgtcgtcacgccgcttgcaatcgggcccaaagacggattgaactggaag
caggccaaaatgttcgcccaggccgtctgcgaacaaatggccgctgacgcacccgacaag
tatctcatcaacatgtcgaagaagcagcgcgagggtaagatctttctcgattatcttcgc
aacgacaccaaatcgaccgcggtcgcgccgctgtcgccgcgcgcgcgtcccggcgctacc
gtatccatgccgctgaactgggcgcaggtaaaaaccggcctcgatccgaaacgcttcacg
ctccgcaccgcgcccgaccttctgaaaaagagcaaggcatgggcggactatgacagcgcc
gcgcgcccgctcgccgccgcgatcggcaggctggtgcgatga

DBGET integrated database retrieval system