KEGG   Nitrobacter winogradskyi: Nwi_1362Help
Entry
Nwi_1362          CDS       T00276                                 

Definition
(GenBank) translation elongation factor 1A (EF-1A/EF-Tu)
  KO
K02358  
elongation factor Tu
Organism
nwi  Nitrobacter winogradskyi
Brite
Translation factors [BR:nwi03012]
 Eukaryotic Type
  Elongation factors
   Nwi_1362
 Prokaryotic Type
   Nwi_1362
Mitochondrial biogenesis [BR:nwi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Nwi_1362
Exosome [BR:nwi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Nwi_1362
  Exosomal proteins of breast cancer cells
   Nwi_1362
  Exosomal proteins of colorectal cancer cells
   Nwi_1362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1498402..1499592
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERNKPHCNIGTIGHVDHGKTSLTAAITKVLAEAGGATFTAYDQIDKAPEEKARG
ITISTSHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPAIVVFLNKCDMVDDPELLELVEMEVRELLSKYEFPGDDIPIIKGSALAALE
DSDAKLGKEAVLELMKAVDAYIPQPERPVDQPFLMPVEDVFSISGRGTVVTGRVERGIVK
VGEEIEIVGIRETQKTTVTGVEMFRKLLDQGQAGDNIGALLRGTKREDVERGQVLCKPGS
VKPHTKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVHLPAGTEMVMPGDNVA
MEVHLIVPIAMEEKLRFAIREGGRTVGAGVVASIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagcaaagtttgaacgtaacaagccgcattgcaacattggaacgatcggtcac
gtcgaccatggcaagacctcattgacggcggctatcacgaaggttcttgcggaagccggc
ggagcgacgttcacggcatacgaccagattgacaaggctcctgaggaaaaggcgcgcggc
atcacgatctcgacgtcgcatgtcgagtatgagacgccgaaccgccactacgcgcatgtc
gactgtccgggccatgccgactacgtgaagaacatgatcacgggcgcggcgcagatggac
ggcgcgattcttgtcgtgtcggctgcggacggcccgatgcctcagacgcgcgagcacatt
cttctggcgcgccaggttggcgttccggcgatcgtggtgtttctgaacaagtgcgacatg
gtcgacgatccggagcttctggaactggtcgagatggaggtccgggagcttttgtcgaag
tacgagtttcccggcgacgacattccgatcatcaagggctcggcgctggcggcgcttgag
gattccgacgccaagctcggcaaggaagcggtgcttgaactgatgaaggcggttgacgcc
tacattccgcagccggagcggccggttgaccagccgttcctgatgccggtcgaggacgtg
ttctcgatttccggtcgcggtacggttgtgacgggacgagttgagcgcggtattgtcaag
gtcggcgaggaaatcgagatcgtcggcatccgcgagacgcagaagacgacggtgacgggc
gtggagatgttccgcaagcttctcgatcaggggcaggcgggcgacaacatcggagcgctg
ttgcgcggcaccaagcgcgaggacgtggagcgcggtcaggttttgtgcaagccgggctcc
gtgaagccgcacaccaagttcaaggcggaagcctacatcctgaccaaggaggaaggtggc
cgtcacacgccgtttttcaccaactatcggccgcagttctatttccgcacaacggatgtg
accggggtggtgcatcttccggccggcaccgagatggtgatgccgggcgacaatgtcgcg
atggaggtgcatctgatcgtgccgatcgccatggaggagaagctgcgcttcgccatccgc
gagggcggtcgtaccgtcggcgcaggcgtcgtcgccagcatcatcgagtaa

DBGET integrated database retrieval system