KEGG   Ornithorhynchus anatinus (platypus): 100074446Help
Entry
100074446         CDS       T01045                                 

Gene name
GYS1
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Starch and sucrose metabolism
Metabolic pathways
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Glucagon signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100074446 (GYS1)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100074446 (GYS1)
   04152 AMPK signaling pathway
    100074446 (GYS1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100074446 (GYS1)
   04922 Glucagon signaling pathway
    100074446 (GYS1)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    100074446 (GYS1)
Enzymes [BR:oaa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     100074446 (GYS1)
Glycosyltransferases [BR:oaa01003]
 Polysaccharide
  Storage polysaccharide
   100074446 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 740 aa AA seqDB search
MPLSRSLSGSSLPGLEDWQDDIDLDNAVLFEVAWEVANKVGGIYTVIQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPLPALKRTLDSMNSKGCKVYYGRWLIEGGPPVILLDVG
AAAWALERWKGELWESCSIGVPWYDREANDALLFGFLTAWFLGEFYAQCEEKPFLIGHFH
EWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDLVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFSLDKTLFFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSNQ
TVVAFFIMPARTNNFNVESLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGNLPDMNKML
DKEDFTMMKRALFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCTQLTSFLYSFCQQSRRQRIVQRNRTERLSDLLDWKY
LGRYYMFARHMALAKAFPDYFTYEPHDADAVSGADGSGRGLCYPRTASVPPSPSLSRHSS
PHQSEGEEEDCDEAERYDEDEEAEKDRRNIRALEWQRRPSPGLLAQSGAKRGSVDTAPSS
SASSLSEPVSPTSSLGEERN
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgagccgcagcctgtctggtagctccctgccggggctggaggactggcaggat
gacatcgacctggacaacgcggtgctcttcgaggtggcctgggaggtggccaataaagtg
ggcgggatctacacggtgatccagacgaaggcgaaagtgaccggggacgagtggggggac
aattactacctggtgggcccctacacggagcagggggtccgcacccaggtggagctgctg
gagcccccgctgcccgcactgaagcgcaccctggactccatgaacagcaaaggctgcaag
gtgtactacgggcgctggctgattgaggggggcccgccggtcatcctgttggacgtgggg
gcggcagcctgggcgctggagcgctggaagggggagctgtgggagagctgcagcatcggc
gtcccctggtacgaccgcgaggccaacgatgccctcctctttggctttctcaccgcctgg
ttcctgggcgagttctacgcgcagtgcgaggagaagccgttcctgatcggccacttccac
gagtggctggccggcgtgggcctctgtttgtgccgggcccgccgcctgcccgtggccacc
atcttcaccacccacgccaccctcctcgggcgctatctctgcgccggggccgtcgacttc
tacaacaacctggagaacttcaacgtggacaaggaggccggcgagcggcagatctaccac
cggtactgcatggagcgtgcggccgctcactgcgcccacgtcttcaccaccgtctcccag
atcaccgccatcgaggcccagcacctgctcaagaggaagcccgacttagtaacccccaac
gggctcaacgtgaagaagttctcggccatgcacgagttccagaacctgcacgcccagagc
aaggcccggatccaagagtttgtgcgcggacacttctatgggcaccttgacttcagcttg
gataagaccctgttcttcttcattgctggacgctacgagttttccaacaagggagcggat
gtgttcctcgaggccctggcccgcctcaactacctgctccgggtgaacggcagcaaccag
acggtggtagcgttcttcatcatgcccgccaggaccaacaacttcaacgtggagtccttg
aagggtcaggccgtgcggaagcagctctgggacacggccaacacggtgaaggagaagttc
ggaaggaaactgtacgagtctctgctggtgggcaacctcccagacatgaacaagatgctg
gacaaggaggatttcaccatgatgaagcgagccctctttgccactcagcgccagtctttc
ccccccgtctgcacccacaacatgctggacgactcttcagaccccatcctcaccaccatc
cgccgcatcggcctcttcaacagcagcgcggatcgtgtcaaggttatcttccaccccgag
ttcctgtcctccaccagcccccttctgccagtggactacgaagagtttgtccgtggctgt
cacctgggtgtcttcccttcttactacgagccctgggggtacacgcccgccgagtgcacg
gtcatgggcatccccagcgtgtccaccaacctgtccggctttggctgcttcatggaagag
cacatagctgatccctcagcctacggcatctacatcctggaccggcggttccgcagcctg
gacgactcgtgcacccagctgacgtccttcctgtacagcttctgccagcagagccggcgc
cagcgtatcgtccagcgtaaccgcaccgagcggctctccgacctgctggactggaagtac
ctgggccggtattatatgtttgcccggcacatggctctggccaaagcttttccagattac
ttcacttacgagccccacgacgccgacgcggtgagcggggccgatggcagtgggcgggga
ttatgctacccccgcacggcctcggtgcccccctcgccttccctgtcccgccactcgagc
ccccaccagagcgagggggaggaggaggactgcgacgaagcagagcgctacgacgaggat
gaggaggcggagaaggaccgacgcaacatccgggccctcgagtggcagcgccgcccctcg
cccggcctcctcgcccagagcggggccaagcgcggctccgtggacaccgccccctccagc
tcggccagctccctcagtgagcccgtcagccccaccagctccctgggggaggagcgcaac
taa

DBGET integrated database retrieval system