KEGG   Ornithorhynchus anatinus (platypus): 100077642Help
Entry
100077642         CDS       T01045                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00250  Alanine, aspartate and glutamate metabolism
oaa00410  beta-Alanine metabolism
oaa00430  Taurine and hypotaurine metabolism
oaa00650  Butanoate metabolism
oaa01100  Metabolic pathways
oaa04727  GABAergic synapse
oaa04940  Type I diabetes mellitus
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    100077642 (GAD1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100077642 (GAD1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100077642 (GAD1)
   00430 Taurine and hypotaurine metabolism
    100077642 (GAD1)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    100077642 (GAD1)
 Human Diseases
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    100077642 (GAD1)
Enzymes [BR:oaa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     100077642 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase OKR_DC_1 SepSecS DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 100077642
NCBI-ProteinID: XP_001514987
LinkDB All DBs
Position
Un
AA seq 708 aa AA seqDB search
MASSAPSSSSSSSNAGQDPNPTNLRPTIHPLPWPEPRFSADPRGAAEEPVRAVIEEGEEG
KRLPKTGSLQSEGMQGPSRFGAESGAQSGRSSTCRQAGGGGARMLWKSLRRAGTREAGKC
GPKQQSQVSTTQPRSLFPSCVLAGPIPLLQPPGGLDQPRWSLCFLQRTNSLEEKSRIVSA
FKERQSSKNQLACENSEQDARFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEVVDILLN
YVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGVRTGHPR
FFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIIGWSNKDGDG
IFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAALGFGTD
NVILIKCNERGKIIPADLEAKILEAKQKGYVPLYVNATAGTTVYGAFDPIQEIADLCEKY
NLWLHVDAAWGGGLLMSRKHRHKLSGVERANSVTWNPHKMMGVLLQCSAILVREKGILQG
CNQMCAGYLFQQDKQYDISYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQVNKCLEL
AEYLYAKIKNREEFEMVFKGEPEHTNVCFWYIPQSLRGIPDSEERREKLHRVAPKIKALM
MESGTTMVGYQPQGDKANFFRMVISNPAATKSDIDFLIEEIERLGQEL
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggcatcttcggcaccttcctcgtcgtcctcctcctccaacgcggggcaggaccccaac
cccaccaacctgcgccccacaatccacccccttccctggcccgaaccccggttctcggct
gaccctcggggggccgcggaggagccggtgcgagcggtcatcgaagagggagaggaggga
aagaggctgccgaaaaccgggtcgctccaatctgagggtatgcaaggtccttcccgtttt
ggggcggaaagtggagcccagagtgggcgcagcagcacctgtcgacaggcaggtggcgga
ggtgctaggatgctgtggaaaagcctgaggagggcgggcacgagggaagctggaaaatgt
ggacccaagcagcagtcccaggtctccacaacgcagccccgcagcctcttcccaagttgc
gtgctggcagggcccatccctctcctgcagcccccgggaggattggatcagccgagatgg
agcctgtgcttcttgcaaagaaccaacagcctggaggagaagagccggattgtgagcgcc
ttcaaggagaggcagtcctcaaagaaccaactggcgtgtgagaatagcgagcaggacgct
cggttccggcgcaccgagacagacttctccaacctctttgccagagacctcctgccggcc
aagaatggggaggagcagacggtgcagttccttctggaggtggtggacatccttctcaac
tacgtgcgcaagacatttgatcgctccaccaaggtgctggacttccaccacccacaccag
ctgctggaggggatggagggcttcaacttggaattgtcagatcaccctgagtccctggag
cagatcctggtagactgcagagacaccctgaaatatggtgtccgcacaggtcatcctcga
tttttcaaccaactctccactggactggatattattggcttagctggtgaatggctgacg
tcaactgcaaacactaatatgtttacatatgaaattgcaccagtgtttgtcctcatggaa
caaatcacacttaaaaaaatgagagaaattattggatggtcaaataaggatggtgatgga
atattttcacctgggggagctatatctaatatgtacagcatcatggctgcccgttacaaa
tattttcctgaagtcaaaaccaaaggcatggctgccgttcccaaactggtcctctttacc
tcagaacatagccattattcgataaagaaggctggagcagcacttggctttggaactgac
aatgtaattttgataaagtgcaatgaaagagggaaaataatcccagctgatttggaggca
aaaattcttgaagccaaacaaaagggatatgttcctctttacgtgaatgcaactgcaggt
accacagtgtatggagcttttgacccaattcaagagattgcagacctatgtgaaaaatat
aacctttggctccatgtagatgctgcctggggaggtgggcttctcatgtccagaaagcat
cgtcataaactcagtggcgtagaaagggccaactcggttacctggaacccacacaaaatg
atgggagtcttgttgcaatgctctgccattctcgtcagagaaaagggaatactccaagga
tgcaatcagatgtgtgccgggtatcttttccagcaagacaagcagtacgatatttcgtac
gacactggagacaaggcaatacagtgtggccgtcatgtggacatttttaagttctggttg
atgtggaaagccaagggaacagtgggatttgaaaatcaggtcaacaaatgcttagaattg
gcagaatatctctatgcaaaaataaaaaacagagaagaatttgagatggtttttaaaggc
gagcctgagcacacaaacgtttgcttctggtatattccacagagtctcaggggcatacca
gacagtgaggagagacgggaaaagctacacagggtggcgccaaaaatcaaagccctgatg
atggagtcaggtaccacaatggttggatatcaacctcagggagacaaagccaacttcttc
cgtatggttatctcaaatcccgcagctactaaatctgacatcgacttccttattgaagaa
atagaaagattggggcaggagctgtaa

DBGET integrated database retrieval system