KEGG   Ornithorhynchus anatinus (platypus): 100081645Help
Entry
100081645         CDS       T01045                                 

Gene name
GSTO1
Definition
(RefSeq) glutathione S-transferase omega 1
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Platinum drug resistance
Pathways in cancer
Chemical carcinogenesis
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100081645 (GSTO1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100081645 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    100081645 (GSTO1)
   00983 Drug metabolism - other enzymes
    100081645 (GSTO1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100081645 (GSTO1)
   05204 Chemical carcinogenesis
    100081645 (GSTO1)
   05225 Hepatocellular carcinoma
    100081645 (GSTO1)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100081645 (GSTO1)
  Drug resistance
   01524 Platinum drug resistance
    100081645 (GSTO1)
Enzymes [BR:oaa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100081645 (GSTO1)
Transporters [BR:oaa02000]
 Other Transporters
  Pores ion channels [TC:1]
   100081645 (GSTO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 245 aa AA seqDB search
MSGLSGVSAKSLGKGSAPPGPVPEGLIRVYSMRFCPYAKRTLLVLNAKGIKHEVVNINLK
NKPEWFFQKHPLGQVPVLETSKGQLIYESSITCEYLDEAYPEKKLFPDDPYEKAYQKMIF
NQFSKVPPLALKCMTGARNGEDCSDLKAELRKEFSMLEEILSRRKTQYFSGDSITMIDYL
LWTWFERLELFKIADCVDHTPNLKLWIAAMTENPFVKAIFTDLKTSQGFMELYLNNSPEA
CDYGL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggactgtcgggggtgtcggccaagagcctgggaaagggcagcgccccgccaggc
ccggtccccgagggcctgatccgagtgtacagcatgaggttttgcccctacgccaagcgg
accctgctggtcctcaacgccaaaggaatcaaacacgaagttgtcaacatcaacttgaag
aataagcctgaatggttctttcagaagcacccccttggccaggtgccagttctggagacc
agcaagggtcagctgatctatgaatcttccatcacctgcgagtacctggatgaagcctac
cctgagaagaaactgttcccagatgacccttatgaaaaggcgtaccaaaagatgatcttt
aaccagttctctaaggtaccacctttggctttgaaatgtatgaccggagcccggaatggg
gaagattgctctgatctgaaggcagaactgcgtaaggaattcagcatgttggaggagatt
ctttcccgccgcaagacacaatattttagcggagactcaataaccatgattgattacctg
ctgtggacgtggtttgagcggctggaactcttcaagatcgccgactgtgtggatcacacc
ccgaatctcaagctctggatcgcagccatgacagagaatccatttgtcaaggctattttc
actgacctgaagacttcccaaggcttcatggagctgtatctcaataacagccctgaggcc
tgtgactatgggctgtga

DBGET integrated database retrieval system