KEGG   Ornithorhynchus anatinus (platypus): 100090114Help
Entry
100090114         CDS       T01045                                 

Gene name
TUFM
Definition
(RefSeq) Tu translation elongation factor, mitochondrial
  KO
K02358  elongation factor Tu
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Translation factors [BR:oaa03012]
 Eukaryotic Type
  Elongation factors
   100090114 (TUFM)
 Prokaryotic Type
   100090114 (TUFM)
Mitochondrial biogenesis [BR:oaa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    100090114 (TUFM)
Exosome [BR:oaa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100090114 (TUFM)
  Exosomal proteins of breast cancer cells
   100090114 (TUFM)
  Exosomal proteins of colorectal cancer cells
   100090114 (TUFM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 100090114
NCBI-ProteinID: XP_001519351
LinkDB All DBs
Position
Un
AA seq 471 aa AA seqDB search
LGARWTRGGRGPALAHLSVSLPQPAVLRSCRSSQLIQSFPKPTLLLDPRLSSTQTLLLSR
GFAVEAKKTYVRDKPHVNIGTIGHVDHGKTTLTAAITKILSEGGGAKFKKYEEIDNAPEE
RARGITINAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQT
REHLLLAKQIGVQHVVVFVNKADAVQDSEMVELVELEIRELLTEFGYNGEKTPVVIGSAL
CALENREPELGVNSVLKLLDAVDTHIPVPTRDLDKPFLLPLESVYSIPGRGTVVTGTLER
GTLKKGDDCEFLGHGKNLRSVVTGIEMFHKSLDRAEAGDNLGALVRGLKREDLRRGLVMA
KPGSIQPHQKVEAQVYVLSKEEGGRHKPFVSHFMPVMFSLTWDMACRVILPPQKEMAMPG
EDVSLTLVLRQPMILEKGQRFTLRDGNRTIGTGLVTGTPALTEEDKLYKWG
NT seq 1418 nt NT seq  +upstreamnt  +downstreamnt
cgttgggcgcccggtggaccaggggcgggaggggcccggccttagctcatctctcggtct
ctctgccccaaccagcagtcctccgaagctgccgctcctcccagttgatccagtcctttc
cgaaaccgacccttctcctcgatccccggctgagctccacccagacgctgctcctctccc
gaggcttcgcggtagaggccaagaagacctacgtacgggacaaacctcacgtcaacatcg
gcaccatcggtcacgtcgatcatggcaaaaccaccctgacagcagccatcactaaaattc
tgtcagagggcggaggtgcaaagttcaagaaatatgaggaaattgacaatgccccggagg
agagagccagggggatcactatcaatgcggcccatgtagaatatagcacggctgcccgcc
actatgcccacactgactgccccgggcacgctgactatgttaagaatatgatcacaggca
cagccccgctggatggttgcatcctggtggtagctgccaacgacggacccatgccccaga
cccgggagcacctgctgctagccaaacagatcggggtccagcacgtcgtggtgttcgtga
acaaggcggacgccgtgcaggattctgaaatggtggagctggtggagctggagatccggg
agctgctcacggaatttggttacaacggggagaagacgcccgtcgtcattggctctgctc
tctgtgcccttgagaaccgggagccggaactgggggtgaactctgtgctgaaactgctgg
atgccgtggacacccacatccccgtgcccacccgggacctggataagccttttctgctgc
ccttggaatctgtgtattccattcctggccgaggcacagtggtgacagggaccctggagc
gtgggacgctgaagaaaggagacgattgtgagtttttgggccacggcaagaacctgcgtt
ccgtggtcacaggaatcgagatgttccacaagagcctggaccgggccgaggccggggata
acctcggggccctcgtgcgggggctgaagcgggaggacctgcggcggggcctggtcatgg
ccaagccgggctccatccagccccatcagaaagtggaggctcaggtgtacgttctcagca
aggaagagggtggccgccacaaaccttttgtctcccacttcatgccagtcatgttttccc
tcacgtgggacatggcctgtagggtaatcctgcccccgcagaaggagatggccatgcctg
gagaggatgtgtcactaactctggtcctgcgccaacccatgatcctcgaaaaaggtcagc
gcttcaccctccgtgacgggaaccgcaccatcggcacgggcttggtcaccgggacgcccg
ccctgaccgaggaggacaagctctacaagtggggctga

DBGET integrated database retrieval system