KEGG   Oscillatoria acuminata: Oscil6304_0034Help
Entry
Oscil6304_0034    CDS       T02368                                 

Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
oac  Oscillatoria acuminata
Pathway
oac00010  Glycolysis / Gluconeogenesis
oac00520  Amino sugar and nucleotide sugar metabolism
oac01100  Metabolic pathways
oac01110  Biosynthesis of secondary metabolites
oac01120  Microbial metabolism in diverse environments
oac01130  Biosynthesis of antibiotics
oac01200  Carbon metabolism
Module
oac_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:oac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Oscil6304_0034
   00520 Amino sugar and nucleotide sugar metabolism
    Oscil6304_0034
Enzymes [BR:oac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Oscil6304_0034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: AFY79794
UniProt: K9TCT8
LinkDB All DBs
Position
complement(44056..44766)
Genome map
AA seq 236 aa AA seqDB search
MVNQVESIKTLAVDIGGSGTKTIVLDAAGEAVTKRNRVPTPDPAKPEPVIEAIASLAKEQ
GEFDRVSVGFPGVVRNGIIYTAVNLHPDWVEFNLAEALTKVLERPVRVCNDADIQGLGAI
SGKGVELTITLGTGFGSGLFVNGTLVPNLELGHHPFRKGDTYEEQLGRAALDKVGDKRWN
RRLEKAIANLEHLFNYDRLYIGGGEAKKITFDLPPNVTVVPNISGLLGGIALWRDP
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggtgaatcaagtggaatccataaaaactctagcagttgatattggcggtagtggcacg
aagaccattgttttagatgcagcaggggaagcggtgactaaacgtaaccgcgttcccact
ccggatcccgctaaaccggaacctgtgattgaggcgatcgcctctttagcgaaagaacaa
ggtgagtttgatcgcgtttcggtcggatttcctggggtggttcgtaatggaatcatctac
actgccgtcaacctccacccggattgggtggagttcaatctcgccgaagcgctgacgaag
gttttggaaagacctgtacgggtttgtaatgatgccgatatccagggtttaggcgcaatt
tccgggaaaggggttgaactcacgattaccctgggaactgggtttggcagtgggttattt
gtgaatggaacactggtgccgaatttggaactcggacatcatccattccgcaaaggtgat
acctatgaggaacaattgggacgtgcggcattggataaagtgggagacaaacggtggaat
cgccgattggaaaaagcgatcgccaatttagaacatttgtttaattacgatcgcctctac
attggtggtggtgaagcgaaaaaaatcacctttgatttaccccccaatgttaccgttgtt
cctaatatcagcgggttattagggggaattgccttgtggcgggacccataa

DBGET integrated database retrieval system