KEGG   Oscillatoria acuminata: Oscil6304_3235Help
Entry
Oscil6304_3235    CDS       T02368                                 

Definition
(GenBank) acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II
Organism
oac  Oscillatoria acuminata
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4017009..4020701)
Genome map
AA seq 1230 aa AA seqDB search
MNYAEYTVPQLDRRCSTFVEILRGRAIQQPDNLAFRFLIDGEILGETLTYRELDRGSRAI
AAQLQAMGLGGERALLLYPPGLDYLIAFFGCLYAGVVAVPAYPPRNQRNTPRILAVLADA
KAAVALTTSQIAAQVQSLLSEKTAGSGLQWVCTDRLDPALDSQWQDPGVTSDSLAFLQYT
SGSTGTPKGVMVSQGNLLHNAAITYKVMDHHPESQFISWLPTYHDMGLIGGILQPLYGGF
PCTLMSPASFLQRPYRWLKAISDYGGTTSGAPNFAYDLCVSKITPEQKATLDLSRWQVAF
NGAEPIRHETLVRFQEAFADCGFQPEAFYPCYGMAETTLMVSGSMTSVPYPWKAIDKGAF
ERNQITDSDSGENAVTLVGCGSAVPDMQIAIAHPETGARCAGNEVGEVWVSGPSVCQGYW
NRPEESRHTFQAFLADSGEGPFLRTGDLGFLEDGELYITGRVKDLILIRGRNLYPQDIER
ATESSHRAFRLTGTAAFTVEVAGEERLVVVQELEFRAKPNLSEAIAAIRQAVAEEFEVQV
YGVVLIKPGTIPKTSSGKIQRRACRDRFLNGELQVVDQSLVASSMSGKLEKNWDRESLLN
LAPEQRQTELIADLTSRVSSLLNVSVVDIDPKQPLSRFGLDSLMAFDLKNQLELAWGVNI
DVVDFFEGISLVELAQKADNLLETQQPIDPIEPVSRTAELPVGLAQERLWFLDRLEPGNP
FYNVAFCLNIVGKLDTKILESSLQELVNRHEGLRTGFPEVKGRPIQQIQASVMGGDFNFE
KRPNPPAPFPAREGGERPNPPAPFPKREGGERDLFPPPLVGEGGRGERSHLFLGQIEMLP
VTVKLPISEVLETEVSTRLQQEAKTPFNLSQAPLLRVHLFRVQDQRHCLSIVLHHIISDG
WSVGVMVREIAAIYEALTAGQAPNLGNLPIQYADFAAWQRQQLQTEGLQRELDYWKQQLQ
GNLSRLNLPCDRPRPEIPTFAGQKCFFQFSPTLSEAVRELNRQEEVTLFMTLLAGFKILL
CCYSQQEDIAVGSPVAGREKPETRGLIGFFINTLVLRTDLSGNPNFREVLQRVRAVASGA
YAHQALPFDKLVEELQPERNLSYNPLFQVMFILQNAPIPTVEIPGLSFESQEVDLGTSKF
DLKVSIWDDPAGFKGSFEYQTDLFNPETIAQMVEDYEGVLHQVVTQPHLRLTELNVYGSC
HQQRQRQAESLQAVSLQKLKLTKRQATRTV
NT seq 3693 nt NT seq  +upstreamnt  +downstreamnt
atgaattacgcagagtacaccgttccacaactcgatcgccgttgttctacttttgtagaa
atcctgcgcgggagagcaatccaacagccggataatctcgcttttcggtttttaatcgat
ggggaaatccttggggaaacccttacctatcgggaattagaccgaggcagtcgggcgatc
gccgctcaattgcaagcaatggggttgggtggggaacgggcattactgctgtatcctccg
ggactcgactatttgattgcctttttcggctgcctgtatgccggagttgttgccgttcct
gcctatccgccccgaaatcagcgtaatacaccgagaattttggcagtcttggcagatgca
aaagcagcagtcgccctcactaccagccaaattgcagcccaagttcaatccttgttgagc
gaaaaaacagcagggagtgggttgcaatgggtgtgtacggatcggttagatccagcgttg
gacagccaatggcaggatccgggggttacgtcagacagtttagcttttttgcaatacacc
tcgggttctacgggaacgccaaaaggggtgatggtatcccaggggaacttgctgcataat
gcggcaattacctacaaagtgatggatcatcatcctgagagtcaatttatttcgtggcta
ccaacgtatcacgatatgggactgattggggggattttacagcccctttatgggggtttt
ccctgcacgttaatgtctccggcttcgtttctacaacgtccctatcgttggctgaaagcg
atttccgattatggggggacgacaagtggtgcacctaattttgcctatgacttatgtgtg
agtaagattacgccggaacaaaaggcaaccctggatttgagtcggtggcaggtggcattt
aatggcgctgaaccgattcgccatgagacgttagtgcgatttcaggaagcctttgcggac
tgtggatttcaaccggaagccttttatccctgttatgggatggcagaaacaacgttgatg
gtgtcggggagtatgacatcggttccctatccttggaaggcgatcgataaaggtgcattt
gaacggaatcagattaccgattcggactcaggggaaaatgctgtaaccttggtgggatgt
ggttctgcggttccggatatgcagattgcgatcgcccatccggaaacgggtgctcgttgt
gcagggaacgaagtgggagaagtgtgggtgtctggacccagtgtctgccaaggctattgg
aatcgtccggaagagagtcgtcatacatttcaagcattcctggctgacagtggagaaggg
ccatttttacgcaccggggatttgggtttcctagaggatggggaactgtatattacgggt
cgggttaaggatttaattctgattcggggacgtaatttatatccccaggatatcgaacgc
gctacggagtcgagtcatcgggcatttcggttgacgggaactgctgcttttaccgtggag
gtggcaggggaagaaaggctggtggtggtgcaagaattggagtttcgcgctaaaccgaat
ttatccgaggcgatcgccgctattcggcaggcagtcgcagaggaatttgaggtgcaagtg
tatggagttgtgctgattaaaccgggtacgattcccaaaacttcgagtggaaaaattcaa
cgccgtgcctgtcgcgatcgcttccttaatggtgaactgcaagtggtggatcaaagtctg
gtagcgtcatcaatgtccgggaaattagagaaaaattgggaccgagaaagtctactcaac
cttgcaccggaacagcgacaaactgagctaattgctgatttaaccagccgagtctctagc
ttattgaatgtttcggttgtagacattgacccgaaacagcccctcagtcggtttggactc
gattcgttgatggcatttgacctcaaaaatcagcttgaattagcatggggtgtcaacatt
gatgtagtagactttttcgagggtatcagtttagtagagttggcccaaaaagcggacaat
ctgctggaaactcagcagccgattgacccaattgagcctgtttctcgcacggcagaattg
cccgtgggactcgcccaggaacggttatggtttttggaccgcttggaaccgggaaatccg
ttttataatgtggcattttgcctgaatattgtcgggaaactggacaccaagattttagag
tccagcctccaagaattggtgaaccgtcacgaagggttgaggactggatttccagaagtt
aaagggcggcccattcagcagattcaagcctcggtgatggggggggatttcaactttgaa
aagagacctaaccccccagcccccttccctgcgagggaagggggagaaagacctaacccc
ccagcccccttccctaagagggaagggggagaaagagatttattcccccctccccttgta
ggggaggggggcaggggggagaggtcccacttgtttttaggacaaatagagatgctcccg
gtaacggtaaaattgccaatctctgaggtattggaaacggaagtatccacccggttgcaa
caggaagctaaaaccccgtttaatctctcgcaagcgcctttattgcgagtccatttattc
cgagttcaggaccagcgccattgtttatcgattgtcctccatcatattatttctgatggc
tggtccgttggggtcatggtgcgcgaaattgccgccatttatgaagcattgacagcgggt
caagccccgaatttaggaaacttacccatccaatatgctgattttgcggcatggcaacgg
caacagctacaaactgagggattacaacgggaattagattactggaagcagcaacttcag
gggaatttatctcggttgaacttaccttgcgatcgccctcgtcctgaaattcccaccttt
gccggtcaaaagtgctttttccaattttctcccaccttgtctgaggcagttcgggagttg
aatcgccaagaagaagtcaccttatttatgaccctgttggcagggtttaaaatcctgtta
tgctgttacagtcagcaagaggatattgcagtcggttcgccggtagcagggcgggaaaag
cctgaaactagaggattaattggcttttttattaatactctcgttttacgaactgatttg
tcaggaaatcccaattttagagaagttttgcagcgagtccgggctgtagcatcgggggct
tatgctcatcaggcgttaccgtttgataaattagtggaagagttgcagccggaacgaaat
ttaagttataatccgttattccaggtgatgtttattctgcaaaacgcgccgattcccacg
gtggaaattcctggactcagttttgagtcccaggaagttgatttagggacttccaagttt
gatttaaaggtcagtatttgggacgatccagcgggatttaaagggtcctttgagtatcaa
acggatttatttaacccagagacaatagcccagatggttgaggattatgaaggggtattg
caccaagttgtgactcaacctcacctgcgattaactgaattaaacgtttatggcagttgc
catcaacaacgacaacgccaagccgaatctttacaagccgttagcttacaaaaactaaag
ctcaccaaacggcaagcaacccgtacagtttag

DBGET integrated database retrieval system