KEGG   Oscillatoria acuminata: Oscil6304_4786Help
Entry
Oscil6304_4786    CDS       T02368                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
oac  Oscillatoria acuminata
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:oac00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Oscil6304_4786
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Oscil6304_4786
   00680 Methane metabolism
    Oscil6304_4786
Enzymes [BR:oac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Oscil6304_4786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(6095874..6098918)
Genome map
AA seq 1014 aa AA seqDB search
MTVRLEPSNSVMTVSSSDLFLRHRLKVVEDLWESVLRTECGQELVVLLAQLRAMYSSEGQ
AYNFSESSVLKLVEQLDLNDAIRAARAFALYFQLINIVEQHYDQRDRLRGGAGPNTGVSE
NQQFDVPKESPYFASSQTVTRRRELANFSALFPKLKQLNVPPQQIQKIMESLDIRLVFTA
HPTEIVRHTLRTKQRRLAQILQELDTLEEGRQPDSQTTSCETKDLIEALTEEIRLWWRTD
ELHQFKPSVLDEVDYTLHYFKEVLFDAVPQLHQRLKRSLQASFPYLQPPRYNFCKFGSWV
GSDRDGNPYCTPSITWKTACYQRQLILDKYMGSLDRLSQLLSLSLHWSDVLPELLESLEQ
DRLQMPDIYEKLAIRYRQEPYRLKLAYICHRLENTRDRNQRLYTESDWNRHLSDIKNAPM
YHSGSEFLDELRLIQRNLAATGLSCRDLEQLICQVEIYGFILAHLDIRQESSRHSTAITE
IAEYLQILPRPYDDLSEAEKTEWLTTELKTRRPLIPGELPFSEQNSEIISTFRMLRALQE
EFGLEICQTYIISMSRDVSDLLEVLLLAKEAGLYDPATGMGTIQVVPLFETVEDLKHAPT
VIEDLFELPLYHALLSGGYQNALPVTATETTGAPNISNLKSSHIQVPKLQEVMLGYSDSN
KDSGFLSSNWEIHKAQKALQLIGDRFGVVLRIFHGRGGSVGRGGGPAYEAILAQPGRSIN
GRIKITEQGEVLASKYTLPELALYNLETIASAVVQSSLLGSGFDDIEAWNQIMEELADCS
RQHYRALIYEQPDFIDFFHEVTPIDEISKLQISSRPARRSSGKRDLGSLRAIPWVFSWTQ
TRFLLPAWYGVGTALNNFLEQEPEEHLKLLRYFYLKWPFFKMVISKVEMTLSKVDLEMAH
HYVRELTQPENRDRFEALFTQIASEFNQTRDLVLAITEHQRLLDGDPDLQRSVQLRNATI
VPLGLLQVSLLKRLREHQSQSVTGVIHSRYSKGELLRGALLTINGIAAGMRNTG
NT seq 3045 nt NT seq  +upstreamnt  +downstreamnt
atgactgtacgactcgaaccctcaaattctgttatgacagttagttcatccgacttattt
ttacggcatcgtctcaaagtcgtcgaggacttatgggagtccgtcctgcggactgaatgc
ggtcaggaattagtggttctactggcgcaattgcgagcaatgtattcctccgagggacaa
gcctacaacttttcggaatccagtgttctgaaattagtagaacagttagacctcaatgat
gcaattcgggccgctcgggcctttgccctgtatttccaactgattaacattgtcgaacaa
cattacgaccagcgcgatcgcctgcggggtggagccggaccgaacaccggcgtctctgaa
aatcagcaattcgacgttcccaaagaaagcccttatttcgccagcagtcaaaccgtgact
cgccgccgcgaattagccaatttttccgctttatttcccaaattaaagcagttgaatgtg
cccccgcagcaaatccagaaaatcatggaaagtctggatattcgcttggtttttacagct
catccgacggaaattgtgcgtcataccctaagaaccaaacagcggcgactggctcaaatt
ttgcaagaactcgacaccctagaagaaggtcggcaaccagatagccaaaccacatcttgt
gaaacgaaagacctgatcgaggcgctcactgaagaaattcgcctgtggtggcgaacggac
gaattgcatcagtttaaaccctccgtccttgatgaagtagattataccctacattatttc
aaagaggtcctatttgatgcagttcctcaacttcatcaacggttaaaacgctcgttgcaa
gcgtccttcccctatctgcaacccccccgttacaacttctgcaaatttggctcttgggtc
ggttcggaccgcgatggaaatccctattgcactccttctattacctggaaaaccgcctgc
tatcagcggcagttaatcctagacaaatacatgggttctcttgatcgcttgtcccaactc
ctgtctttgtctttgcactggagtgatgtcttacccgaactcctcgaatccctggaacaa
gaccgactgcaaatgccagacatctatgagaaactggcaattcgctatcgacaggaaccc
tatcggttaaaactcgcctatatctgccatcgcttagaaaatacccgcgatcgcaatcag
cgtctttacaccgaatccgattggaatcgtcatttgagcgatatcaaaaacgctcccatg
tatcactctgggtcggaatttcttgacgaattacgcctgattcaacgcaatttagccgca
actgggttaagctgtcgagacttggaacaactcatctgtcaagtcgaaatctatggcttt
attttggcccatttagatattcgccaagagtcatctcgccacagtacagccatcacagaa
atcgcggaatatctgcaaatcttaccccgcccttacgatgacctatcggaagcggaaaaa
actgaatggttgaccacagaactgaaaaccagacgtcctttaatccccggagaactgccc
ttttctgagcaaaacagcgagattatttccacctttagaatgctgcgggcgcttcaagaa
gagtttggcttggaaatctgtcaaacttacatcattagcatgagccgtgatgtcagtgat
ttgttagaagtcctcctgcttgccaaagaagcgggtctttatgaccccgctaccgggatg
ggaacaattcaagtcgtccccttatttgaaaccgtagaggatttaaaacacgcaccgacg
gtcattgaggacctgtttgaacttccgctttatcatgctttactctctgggggataccaa
aatgctctcccggtaaccgccacggaaacaacgggtgcgccgaacatttctaatctgaaa
tcttctcacattcaggttcctaaattgcaggaggtgatgctggggtattccgatagtaat
aaagattcgggatttttaagcagtaactgggaaattcataaagcccagaaagcgctccaa
ctgattggcgatcgctttggcgttgtcctgcggatctttcacggtcgcggcgggtctgtc
ggtcgcgggggcggtccagcttatgaagcgattttagctcaaccgggtcgcagtattaac
gggcgcattaaaattaccgaacaaggggaagttttagccagtaaatacaccttgcctgag
ttagccctttataacttagaaaccatcgccagtgctgtggttcaaagtagcttactcggg
tccggctttgatgatatcgaagcctggaatcaaatcatggaagagttggccgattgttca
cgccaacattatcgcgccttgatttatgaacaacctgattttatcgatttctttcatgaa
gtcacccccattgatgaaatcagcaagctacaaatctcttcgcgacccgcaagacgcagt
agcggcaaacgagatttaggttccctccgggccattccttgggtctttagctggacccaa
actcgcttccttctccctgcttggtatggagttggaactgctttgaataattttctagaa
caggaaccggaagaacatctgaaactcctgcgctatttctatctgaaatggccgttcttt
aagatggtgatttctaaagtagaaatgaccctctctaaggtggatctagaaatggcccat
cactatgttcgggaactcacccaaccggaaaatcgcgatcgctttgaagccctgttcact
caaattgccagcgaatttaaccaaacccgcgatttagtgctggcgattaccgaacatcaa
cgcctgttagatggagacccggatttacagcgatcggtccagttacgaaatgccaccatc
gtccccctgggtttattacaagtctccctcctcaaacgcctgcgcgaacatcaaagtcag
tccgtgacaggagtaattcactcccgatacagcaaaggcgaattgctacgcggtgcccta
ttaaccatcaacggcatcgctgccggcatgagaaataccggctga

DBGET integrated database retrieval system