KEGG   Oscillatoria acuminata: Oscil6304_5944Help
Entry
Oscil6304_5944    CDS       T02368                                 

Definition
(GenBank) phosphodiesterase/alkaline phosphatase D
  KO
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
oac  Oscillatoria acuminata
Pathway
Folate biosynthesis
Metabolic pathways
Two-component system
Brite
KEGG Orthology (KO) [BR:oac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Oscil6304_5944
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Oscil6304_5944
Enzymes [BR:oac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Oscil6304_5944
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(7614223..7615866)
Genome map
AA seq 547 aa AA seqDB search
MNRPLKFYDAQQRPWPNSPLEQTSIIGHTTPTTVRLWFRVSEPGEYWLVVSSRPIPTQGI
PLLILGDRREYQLRLTTPTHTEEFFPEIVLPVSFTPETDLTGVMELMNLTPDTRYYYALF
DPNRDSPWELGHEELLWFNTFPEHPKTINFGIYSCHMPYEGRQLANVEMWDRFNEELSKV
NARFVLATGDQVYVDGNAELSIWEWLRKVKSENPTREDMITWYRDIYRGYWGIPEVQRIY
RRFPTYMIWDDHEIVDGWGSYTPDELAGLLDTSWQLRNTQEQLQFADEMFEAARQVYWEY
EHSHNPETDFVNNQFDYGFDCGRCAFYVLDMRGNRNYNREHHRSLGLEQGSRFEKWIANQ
YQSDAEVLFIVSPVPVVHLSSFVINKIDLSLFGYQDDQRDHWEHESNWDERNQLLKWVFQ
FAQETGKRVIFISGDVHIGAAFKLTHSEFPGAKVFQVTSSGIAYAHLKELERKILEMLVK
PEGDLGDRPKNIPYHFENLAVCRYNNFGILRVTEEDSGGMEVCFDLYGGNREESGELSLF
KTSIMLA
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgccctctaaaattttacgatgctcaacagcgtccttggccgaattcaccctta
gagcaaaccagtattatcggtcatacgacccccaccacggtgcgcctgtggttccgggtt
tctgaaccgggggaatactggttagtggtgtcttctcgtcccattcccactcaggggatt
cctttgttgattttaggcgatcgccgtgaataccagttacgcttgaccactccgactcat
acagaagaatttttcccagaaatcgttctccccgtctcattcaccccagaaaccgacctc
accggcgtcatggaactgatgaatctcacgccggatactcgttattattatgcgttattt
gaccccaaccgggattctccctgggagttgggacatgaggaactcctgtggtttaacacc
tttcccgaacatccgaaaaccatcaattttggcatctatagttgtcatatgccttatgaa
gggcggcagcttgctaatgtggaaatgtgggaccgatttaatgaggaactctccaaggtt
aatgcgcgatttgtgttagcaacgggagatcaagtctatgtggatggcaacgccgagttg
agtatctgggaatggttgcggaaggtcaaatctgagaatccgactcgcgaggatatgatt
acttggtatcgggatatatatcggggatattggggaattccggaagtgcagcgcatttat
cgccgctttccgacttatatgatttgggatgatcatgaaattgtcgatggatgggggtct
tatactcccgatgaactagcgggattgctagatacctcctggcaactgcgaaatacccag
gaacaattgcagtttgccgatgaaatgtttgaagcagcgcgccaggtttattgggaatat
gaacattctcataatcctgagactgattttgtgaataatcagtttgattatggatttgat
tgcggacgctgtgctttttatgtcttagatatgcgcggaaatcgcaattacaatcgcgaa
catcatcgttcattagggttagaacaggggagtcgatttgaaaaatggattgccaatcag
tatcaatccgatgccgaagttttatttattgtgtctcctgttccggtggttcatttaagt
agttttgtgattaacaaaattgacttaagtttgttcggatatcaagatgaccaacgggac
cattgggaacatgaaagcaattgggatgagcgaaatcaattgttaaagtgggtatttcag
tttgcccaagaaaccggcaaacgggtgatttttattagtggggatgttcatattggggca
gcttttaaactcacccattctgagtttcctggggcaaaggtctttcaggtgacttccagt
gggattgcttatgctcatttgaaggaactggaacgaaagattttggagatgttagttaaa
ccggaaggagatttaggcgatcggccaaaaaatattccctatcattttgagaatttggcg
gtctgtcgttataataattttggcattcttagagttacggaagaggactcaggagggatg
gaagtttgctttgatttgtatgggggaaatcgtgaagagagtggggaactttctttgttt
aagacgagtattatgttggcataa

DBGET integrated database retrieval system