KEGG   Ochrobactrum anthropi ATCC 49188: Oant_1445Help
Entry
Oant_1445         CDS       T00568                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Oant_1445
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Oant_1445
Enzymes [BR:oan01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Oant_1445
Peptidoglycan biosynthesis and degradation proteins [BR:oan01011]
 Precursor biosynthesis
  Racemase
   Oant_1445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1:complement(1529540..1530682)
Genome map
AA seq 380 aa AA seqDB search
MVEMSMQFSQDERDLAAGGVLTIDLSALRHNYSAIARHIAPTRAAAVVKADAYGLGASRV
APAFYDAGCRDFFVAHLGEAIALKPFIQPDATLYVLNGLQPGTEEACAREGILPVLNSLE
QIENWAALATRQGKKLPALLQLDTGMSRLGLSPKEFERFLENATLLDAIDIKFVISHLAS
GDEPENAANARQLANMTALLARLPKLPVAFANSGGSFLDKTYHFDLARPGVALYGVGPKS
EIIPVLTLSARVIQVRDIDKGAAVGYGGAYIAEGPMRVATIAVGYADGWFRSLSNKGAAF
FGDTRLPIIGRVSMDSITLDVSALPEGTLKLGSLVELIGPHQRLEDVARDCDTIPYEILT
ALGNRYARVYVESGASDIKV
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggttgagatgtcgatgcaattttcacaggatgagcgcgatcttgccgccggtggcgta
ttgaccatcgacttgtcggcgctgcgtcacaattattcggccattgcccgtcatatcgca
cccacccgcgctgctgccgttgtgaaggcagatgcctacgggctcggcgccagtcgtgtt
gcgccagctttttacgatgccggttgccgtgacttcttcgtcgcccatctcggcgaagcc
attgcgctgaagccgtttatccagcccgatgcgacgctctacgttttgaacggtcttcaa
ccggggacggaagaagcctgcgcccgcgaaggcattctgccagttctcaactcgctggaa
cagattgaaaactgggcggcactcgccaccagacagggcaagaagctgcccgccctgctg
cagctcgataccggcatgtcgcgtctcggcctgtcgccgaaggaatttgaacgctttctt
gagaacgccacgcttctggatgccattgacatcaagtttgtcatcagccacctggccagc
ggtgacgaaccggaaaatgcggcaaatgcccgtcagcttgccaatatgaccgccttgctt
gcgcgcctgccaaaactgccggttgctttcgccaattccggcggcagcttcctcgacaag
acctatcatttcgacctcgctcgccccggtgtcgcgctttatggcgttggaccgaaaagc
gagatcattcctgtcctcaccctttcggcacgcgtcattcaggtgcgcgacatcgacaag
ggggcggcggttggctatggcggcgcctatatcgccgaagggccgatgcgggttgcaacg
attgctgtgggatatgccgatggctggttccgttctctcagcaacaagggggcggccttc
tttggcgatacgcgactgccgatcatcggccgtgtgtcgatggactcgatcacgctcgac
gtcagcgcgttgccggaaggcacgctgaaactcggcagtcttgtggagctgatcggcccg
caccagcgcctcgaagacgtggcgcgcgattgcgacactattccctatgaaattctgact
gcgctcggcaaccgttatgcacgtgtctacgtggagagcggcgcgagcgacataaaagta
taa

DBGET integrated database retrieval system