KEGG   Ochrobactrum anthropi ATCC 49188: Oant_2159Help
Entry
Oant_2159         CDS       T00568                                 

Definition
(GenBank) Phosphoribosyl-AMP cyclohydrolase
  KO
K01496  phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
oan  Ochrobactrum anthropi ATCC 49188
Pathway
oan00340  Histidine metabolism
oan01100  Metabolic pathways
oan01110  Biosynthesis of secondary metabolites
oan01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:oan00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Oant_2159
Enzymes [BR:oan01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     Oant_2159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH AfaD BNR_2
Motif
Other DBs
NCBI-ProteinID: ABS14875
JGI: Oant2159
UniProt: A6X0X1
LinkDB All DBs
Position
1:2267250..2267675
Genome map
AA seq 141 aa AA seqDB search
MSFFPAQPSDKKAIEEGAAFMPRFDASGLITAVVTDARDGELLMVAHMNEEALRLTLETG
IAHYWSRSRGKLWKKGETSGNLQSVVELRTDCDQDALWLKVRVAGDGPTCHTGRRSCFYR
QVVAENGDISLAIEGACDHEH
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgagcttctttcctgcccagccttccgacaagaaggccatcgaagaaggtgcggcattc
atgccgcgattcgatgcatcggggctgatcactgccgtcgtaaccgatgcgcgtgacggc
gagttactgatggtcgcccatatgaatgaggaagccttgcgccttaccctcgaaacggga
attgcgcattactggtctcgttcgcgcggcaagctctggaagaagggcgagacgtcgggc
aatctgcaaagcgttgtcgagttgcgcacggattgcgaccaggatgcgctttggctgaaa
gtgcgcgtcgccggtgacgggccgacctgccatacaggccgccgctcctgcttctatcgg
caggttgttgccgagaacggcgatatatcgctggctattgaaggcgcttgcgatcacgag
cattaa

DBGET integrated database retrieval system