KEGG   Octadecabacter arcticus: OA238_c27350Help
Entry
OA238_c27350      CDS       T02539                                 

Definition
(GenBank) putative ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
oar  Octadecabacter arcticus
Pathway
oar03030  DNA replication
oar03410  Base excision repair
oar03420  Nucleotide excision repair
oar03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:oar00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    OA238_c27350
   03410 Base excision repair
    OA238_c27350
   03420 Nucleotide excision repair
    OA238_c27350
   03430 Mismatch repair
    OA238_c27350
Enzymes [BR:oar01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     OA238_c27350
    6.5.1.6  DNA ligase (ATP or NAD+)
     OA238_c27350
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     OA238_c27350
DNA replication proteins [BR:oar03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    OA238_c27350
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     OA238_c27350
DNA repair and recombination proteins [BR:oar03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     OA238_c27350
   NER (nucleotide excision repair)
    Other NER factors
     OA238_c27350
   MMR (mismatch exicision repair)
    Other MMR factors
     OA238_c27350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: AGI72771
UniProt: M9RQN9
LinkDB All DBs
Position
2914080..2915669
Genome map
AA seq 529 aa AA seqDB search
MKDFATLFTAVDQSTKTTVKVAAMADFFRTASDSDKLWCVALFSGRRPRRVITTKLLREW
AAERAGLPLWLLEECYPIVGDLAETISLFLPPSVGTEDRSLTEWILNLKRLSTLDEDDRK
AGILAAWDALPQTESFLFIKLLTGGFRIGVSQKLMTRALAIATGQDEAALTHKLMGKWTP
ETVTWNSLIEVDDPSADLSRPYPFYLAYGLEKIDRLGPSSDWFIDRKWDGIRGQFILRGG
EHHIWSRGEDLMTDRFPELAQLRDCLPDRTVIDGELLAFQNDAPMSFNALQKRIGRKTVP
KKLLAEAPVILMAYDLLECDGVDIRNETLETRRNLLEKILNSVPSDAPIRISPEVTGDTW
EDFRKERAKSRDLSAEGLMLKRRDSPYLAGRKKGDWWKWKIDPLTVDAVMIYAQAGSGRR
ANLFTDFTFAVKNGNDLVPFTKAYSGLTDAEFRQITTWVKRNTVQRFGPVRSVPAEHVFE
IAFEGIQASPRHKSGIALRFPRMLRWRQDKPLDEINTLDDLKEMLAKYG
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacttcgcaaccctgttcaccgccgtggatcagtccaccaaaacgacagtcaaa
gtcgccgcaatggctgacttttttcgcacagctagcgacagtgacaaactctggtgcgtg
gccttgttttccggtcgccgcccacgccgcgtgatcaccacaaaactgctgcgtgaatgg
gcagccgaacgcgccggattaccgctgtggctgcttgaggaatgttacccgattgtcggt
gatctggcagaaacgatcagcctgttcctgccaccgtccgttggaactgaagatcgatcc
ctgacggaatggatattaaatctaaaacgcctttcaacgttggatgaggacgaccgcaag
gctggcatcctcgccgcgtgggacgcattgcctcaaaccgagagttttttgttcataaaa
cttctcactggtgggttccgcatcggcgtcagccaaaaactaatgacccgcgccttggca
atcgccaccggccaagatgaggccgcattgacccataaactgatgggcaaatggacacca
gaaaccgtgacttggaacagcctgatcgaagtggacgacccaagcgcggacctgtcgcgt
ccatacccgttttatctggcgtatggattggaaaaaatagatcgacttggtccttcaagc
gattggtttattgacaggaaatgggacggtatacgcggtcaattcatcctgcgcggtggg
gaacatcacatctggtcgcgcggcgaagacttaatgacagaccgctttcccgaacttgca
cagctgcgcgattgcctgcccgatagaacggtcatagatggcgaactcttggcgtttcaa
aacgatgcaccgatgtcatttaatgccctgcaaaaacggatcggcagaaagacagtacca
aagaaattgctggcagaggcgcccgtgatcttgatggcgtacgaccttcttgagtgtgac
ggcgtcgatatcagaaatgagaccctagaaacgcgccgtaacctgctggaaaagatactg
aattccgttccttccgacgcacccatccgaatttcaccagaagtcacgggcgacacgtgg
gaggacttcagaaaggagcgcgcaaagtcacgtgatctcagcgccgaggggttgatgtta
aaacggcgcgacagcccctatttggcaggtcgcaaaaagggcgattggtggaaatggaag
atcgatccgctgacagtggatgccgtgatgatatacgcacaagccggatcggggcgtcgc
gcaaacctgttcaccgacttcacctttgcggtcaaaaacggcaacgatcttgtccccttc
acaaaggcatattcagggctaacagatgcggaatttcgccaaatcaccacttgggtcaaa
cgcaatacagtgcagcgtttcggccccgttcgatccgtccccgcagagcacgtttttgaa
atcgcgtttgaaggcatacaagcttcaccgcgacataaatcaggcattgcgttacgcttc
ccacgcatgcttcgttggcgacaagacaaaccactggatgaaatcaacacccttgatgat
ttaaaagaaatgttggcgaagtatggatag

DBGET integrated database retrieval system