KEGG   Ovis aries (sheep): 101105177Help
Entry
101105177         CDS       T03117                                 

Gene name
TGM3
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase E
  KO
K05620  
transglutaminase 3 [EC:2.3.2.13]
Organism
oas  Ovis aries (sheep)
Brite
Enzymes [BR:oas01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101105177 (TGM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
13
AA seq 691 aa AA seqDB search
MSGLQGVNWQTASNRQAHHTDRFYSQDLIVRRGQPFHMSVTLSRGLSSGGSVTFTVSTGP
YPSESAKTKAVFPLSNGTSSSGWGAQLVSNRNNVLNISILSPANAPIGRYTLNMQISSQG
SDSMLKLGTFILLFNPWLQADGVFMSNHAEREEYVQEDAGIIFVGSTNRIGMIGWNYGQF
EEGILNICLSVLDNSLNFHRDPATDVAHRNDPKYIGRVLSAMINANDDNGVISGNWSGSY
TGGRDPRNWNGSVEILKEWQRSGFRPVRYGQCWVFAGTLNTVLRCLGIPSRVITNFNSAH
DTDRNLSVDVYYDPLGRPVEKGSDSVWNFHVWNEAWFVRSDLGPSYNGWQVLDATPQERS
QGVFQCGPASVIAIREGNVDWDFDMPFIFAEVNADRITWIYESSGALKKNSSDTHSVGKY
ISTKAVGSNSRVDVTEKYKYPEGSSQERQVFEKALRKLKPRVSFSATSASSLARDEPEPS
ISGRFKVAGVLAVGKEVNLVLILKNLTSDTKTVTVNMTAWTIVYNGTLVHEVWKDSVTKS
LNPEEEIEHPVKITYAQYEKYLKADNMIRTTAVCQVTDEPEVVVERDVILDNPTLTLEVL
DEARVQKPVNVQMLFSNPLDEPVKDCVLMVEGSGLLLGSLKIDVPALRPKERSRVRFEIL
PTRSGTKQLLANFSCNKFPAIKAMLSVDVAE
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgtctggactccagggtgtcaactggcagacagcctccaaccggcaggcacatcacaca
gacaggttctacagccaggatctcatcgtacggagaggccagcccttccatatgtcagtg
accttatcccgaggtctcagctctggaggaagtgtgacattcacagtttccacagggcct
tacccctcagagtcggccaagacaaaggctgtgtttccactctccaatgggacaagtagc
agcggctggggtgcacaacttgtgtccaacaggaacaatgttctgaacatctccatcctt
agccctgcaaatgcacccattgggaggtacacgctaaacatgcagatctcctcccagggc
agtgactccatgctgaaacttggaacattcatactgctctttaatccctggctgcaagct
gatggtgtctttatgagtaaccatgctgagagagaggaatatgttcaggaagatgctggc
atcatctttgtgggaagcacaaatcgaattggcatgattggctggaactacggacagttt
gaagaaggcattctgaacatttgcctctcagtcctggataacagtctaaattttcaccgt
gaccctgctacggatgtggcccacagaaacgaccccaaatatattggccgggttctgagt
gcaatgatcaatgccaatgatgacaatggcgtgatttctgggaactggagcggtagctac
actggtggccgggatcctaggaactggaatggcagcgtggaaatcctcaaggagtggcaa
agatctggcttcaggcccgtccggtacggccagtgctgggtctttgctggaaccctcaac
acagtgttgcgatgtttggggattccctcccgagtgatcaccaacttcaactcagctcat
gacacagacagaaacctcagcgtggatgtctactacgaccccttgggacggcccgtggaa
aaaggcagtgatagcgtgtggaatttccacgtctggaatgaagcctggtttgtgcggtct
gacctgggcccttcatacaatggatggcaggttctggacgccacccctcaggagagaagc
caaggggtgttccagtgcggccctgcttcggtgatcgctatccgagagggtaatgtggac
tgggacttcgacatgcccttcatctttgcggaggtcaatgccgaccgcatcacgtggatc
tacgagtcgagtggtgccttgaagaagaattcctcagacactcacagcgtcggcaagtac
atcagtaccaaggcggtgggcagcaactctcgcgtggatgtcaccgaaaagtacaagtat
ccagaaggctccagccaggaaagacaagtatttgaaaaggctttgaggaaacttaagccc
agagtatcctttagcgcaacatctgcaagcagcctggcaagagacgaaccggagcccagc
atctctgggaggttcaaggtcgctggtgtactggccgtgggcaaagaagtcaacctggtc
ctaatactcaaaaacctaacaagtgatacaaagacagtgacagtgaatatgacagcctgg
accatcgtctataacggcactctcgtacacgaggtgtggaaggactctgtcactaaatcc
ctgaatcccgaagaagaaatagagcaccctgtaaagatcacatacgctcagtacgagaag
tacctgaaggcggacaacatgatccggaccacagccgtgtgccaggtcactgacgagcct
gaggtggtggtggagagggacgtcatcctggacaaccccaccctgacccttgaggtgctg
gacgaggcccgggtgcagaagcctgtgaacgtgcagatgctcttttccaacccactggat
gagccggtgaaggactgcgtgctgatggtggagggcagtggcctgctgctgggaagcctc
aagatcgatgtgccagcgctacgccccaaagagcggtcccgcgtgcgttttgagatcctg
cccacccggagtggcaccaagcagctcctcgccaacttctcctgcaacaagtttcccgcg
atcaaggccatgctgtccgttgatgtggctgagtga

DBGET integrated database retrieval system