KEGG   Ovis aries (sheep): 101109916Help
Entry
101109916         CDS       T03117                                 

Gene name
TGM5
Definition
(RefSeq) LOW QUALITY PROTEIN: protein-glutamine gamma-glutamyltransferase 5 isoform X1
  KO
K05622  
transglutaminase 5 [EC:2.3.2.13]
Organism
oas  Ovis aries (sheep)
Brite
Enzymes [BR:oas01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101109916 (TGM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
18
AA seq 691 aa AA seqDB search
MRHHTDEISSNRLLVRRGQAFNITLYFRNRAFQPGLDNIIFVTETGPLPDLPKGTRAVFS
LAGHRGPSPWIASLQTIGASSLEVSLCAPPVAAVGRYLLKVHIRSLQGPVTAYQLGEFIL
LFNPWCPEDAVYLESEPQRQEYVMNDYGFIYQGNKNWIRPCPWNYGQFEENIIDICLELL
DKSLNFQIDPATDCALRGSPVYISRVVCAMINSNDDSGVLNGNWGENYSDGTNPTEWMGX
ATGCQPVRYGQCWVFAAVTCTVMRCLGIPTRVITNFNSGHDTDGNLIIDEYYDNTGRILE
NKKKDSVWNFHVWNECWMARNDLPPGFGGWQVLDATPQETSNGLYCCGPASVRAIKEGEV
DLNYDTAFAFSMVNADCMAWLVFGGKEQKLHQDTNTVGNFISTKSIQSDERDDITENYKY
EEGSLQERQVFLKALQKLKAGRFPGSLRAESQPRSVPPSDSPRSLATPSLQPSDVVQVSL
KFQLLDSPNMGQDIRFVLLALNMSPQLKDLRVNLSAQSLLHDGSPLLPFWQDTAFITLSP
EEAKTYPCKITYSQYSQYLSTDKLIRISALGEEKNSPEKILVNKIITLAYPSIVINVLGA
AIVNQPLSIQVVFSNPLSEQVEDCVLTVEGSGLFRRQQRVLIGVLKPHHRASLTLETIPF
KSGQRQIQANLRSNKFKDIKGYRNVYINFGL
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgcggcaccatacagacgagatcagctccaaccgcctccttgttcgccggggccaggcc
ttcaacatcaccctgtacttcaggaaccgggccttccagccaggcctggacaacatcatt
tttgtgactgagactggaccgctgccagatctgcccaaggggactcgagccgtgttcagc
ctggcaggtcaccgtggccccagcccctggatcgcctcactgcagaccatcggggccagt
tccctggaggtgagcctgtgtgcccctcctgtggcagctgtgggtcggtacctcttgaag
gttcacatcagatccctacaggggcctgtcacagcctaccagcttggggagttcatcctg
ctcttcaatccctggtgcccagaggatgctgtctacctggagagcgaaccccagaggcag
gaatatgtcatgaatgattatggcttcatctatcaagggaacaagaactggatccgcccc
tgcccctggaattatggacaatttgaagagaatatcatagacatctgtctggagctgcta
gacaagagcctgaacttccagattgacccagccacagactgtgccctacggggcagccct
gtctacatcagcagagtggtgtgtgccatgatcaacagcaacgatgacagtggggtgctc
aatggaaactggggcgagaattactcagacggcaccaaccccacggagtggatgggcnag
gccacgggctgccagccagtgcgctacgggcagtgctgggtctttgctgctgtcacatgc
acagtgatgaggtgcctggggatccccactcgagtgatcaccaacttcaactctggccac
gacacagatggaaacctgatcattgatgagtattatgacaacacaggcaggattttggag
aataagaagaaggacagtgtctggaatttccacgtctggaatgaatgctggatggcacgg
aacgacctcccacctggattcggaggctggcaggtgctggacgccacacctcaggagaca
agcaatggcctctactgctgcggccctgcctctgtcagagccatcaaggaaggagaggtg
gacctgaactacgacacagccttcgccttttccatggtgaatgctgactgtatggcctgg
ctggtctttggagggaaggagcagaaacttcaccaggacaccaatactgttggcaatttt
attagcaccaagagcatccagagtgatgagcgggatgacatcacagaaaactacaagtat
gaagaaggttctctgcaggagaggcaggtgtttctgaaggctcttcagaagctgaaggct
ggaaggttcccaggctccctccgagcagaatcgcaacctaggtccgtgccaccgagtgac
agtccgcggagcctggctactccttctctccagcccagtgatgttgtccaggtctccctg
aaattccagctgctcgactcgcccaacatgggccaggacataaggtttgtcctgctggcc
ctcaacatgtcgccccagctcaaggacctcagagtgaacctgagtgcccagtctctgctg
catgatggcagccccctgctcccattctggcaggacacagccttcatcacactctctcct
gaagaagcaaagacctatccctgcaaaatcacctattcccagtacagccagtacctgtcc
acagacaagctgatccgcatcagtgccctgggtgaagagaagaacagtcccgagaagatc
ctggtgaacaagatcatcaccttagcctatcccagcatcgtgattaatgttttaggagca
gccattgtgaaccagccgctctctatacaggtggtattttcaaaccccctctcggagcag
gttgaagactgtgtgctgactgtggaaggaagtggtctcttcaggagacagcagagagtc
ctcattggagtcctcaaaccccatcacagagccagtctcactctggagactatccccttc
aagagtggccaaaggcaaatccaagcgaatctgaggagcaacaaatttaaggacatcaag
ggttacaggaatgtctatataaactttgggttataa

DBGET integrated database retrieval system