KEGG   Ovis aries (sheep): 101114649Help
Entry
101114649         CDS       T03117                                 

Gene name
SETD2
Definition
(RefSeq) histone-lysine N-methyltransferase SETD2 isoform X2
  KO
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
oas  Ovis aries (sheep)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:oas00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101114649 (SETD2)
Enzymes [BR:oas01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101114649 (SETD2)
Chromosome [BR:oas03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101114649 (SETD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
19
AA seq 2556 aa AA seqDB search
MIYFLFFCMLSWLDDNREEENEAKIENVPKTGFIKGPMFKGVASSRFLPKGTKTKVNLEE
QGRQKVSFSFSLTKKTLQNRFLTALGNEKQNDTPNSPVVPLQVDSTPKVKTDIGDTLSTT
EESSPPKSRVELGKIHFKKHLLHVTSRPLLTATTAVASLSPPMAPLPAVIAESTTVDSPP
SSPPPPPPPPQATTPSSPAPVTEPVALPHTPVAVLMTAPVDVAARALKEPPVTVVPESSE
VDTKQDLVSNSSEEHITHSLHEQADIPSQKEDSHIGKEEETPDSSKSSLGSKKTGSKKKS
SQSEGTFLGSESDEDSVRTSSSQRSHDLKFSANIDRERDSKKSLATFKSEDLGKSSRSKT
ERDDKYFSYSKLERDTRYISSRCRERERRRSRSRSRSDRGSRTSLSYSRSERSHYYDSDR
RYHRSSPYRERTRYSRAYTDSRARESSDSEDEYKKTYSRRTSSHSSSYRDLRTSSSYSKS
DRDCKTESSYLEIEKRGKYSSKLERESKRTSENEAMKRCCSPPNELGFRRGSSYSKHDNN
ASRYKSAPSKPVSKSDKFKNSFCCTELNEETRQSHSFSLQTPCSKGSELRVISKIPEREK
TRSPSPSNRLNDSPTFKKLDGSPVFKSEFIGHDSHDSIKEVDSLCKVKNDQLRSYCPTEL
NINGSPGAESDLAAFCTSKHDTVLMSSDDSVTGSEVSPSVKTCMLSSNGFQNTNRFKEKD
LDDTCMKHSKSESASRETEPLVSPHQDQLISLPVITIDYSKTVVKEPVEVRVSCCKTKDS
DIYCTSNDNHTSSCHSGAENTEPLVSKMSSNSFMNVHLKSKTVICDNGNLTDQHSKFACG
EYKQSVGSTSSASVNHFDDLYQTPGSSCIASSLQSLPPGMKVNSLTLLQRGENISPVLDA
VLKSKNSEFLKHAEKETVIEVGGDLPDSGRGFASWDSRHNNGLSEKCVQEAHEEGNSLLP
DRRGRPEISLDEEGGRGHAHISDDSEVVFSSCDLNLTMEDSDGVTYTLKCDSSGHASEIV
STVHEDYSGSSESSSDESDSEDTDSDDSSIPRNRLQSVVVVPKNSTLTMEETSPCSSRSS
QSYRHYSDHWEDERLEPRRHSYEEKFESITSKSCPQTEKFFFHKAAEKNSEISFIQPSRK
QIDNHLPEIAHPQSDGVDSTSHPDIKSDPLGHSNSEEMVKTKIASQQQEELPVYSSDDFE
DVSSKSRQQTAFPIRADSRLGKTDSSFSSSYEISRMDGVRSSEELRNLGWDFSQQEKPTS
TYQQPDSSYGACGGHKHQQSAEQCSGVRSYWQGNGYWDPRSASRPPGAGLVYDRVQGQVP
DSLTDDREEEENWDQRGGSHFSSQSSKFFLSLQKDKGSVQAPEISSNSIKDSLAVNEKKD
LLKNLDRNDMKDRGPLKKRRQELESDSESDGELQDRKKVRVEIEQGETAVPLGSALVGPS
CVMEDFRDPQRWKEYAKQGKMPCYFDLIEENVYLTERKKNKSHRDIKRMQCECTPLSKDE
RAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRAAK
DLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMN
HSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFCGSANCRGY
LGGENRVSIRAAGGKMKKERSRKKDSVDGELEALMENGEGLSDKNQVLSLSRLMVRIETL
EQKLTCLKLIQNTHSQSCLKSFLERHGLSLLWIWMAELGDGRESNQKLQEEIIKTLEHLP
IPTKNMLEESKVLPIIQRWSQTKTAIPQLSEGDGYSSENTSRAHTPLNTPDPSTKLNAEA
DTDTPKKLMFRRLKIISENSMDSAISDATSELEGKDGKEDLDQLENVPIEEEEEPQPQQL
LVQQLPEPKVDSDIAAEASKLPTSELEADAEIEHKESSGAKLDEPIAEETPSQDEEEGVS
DVESERSQEPPDKTVDISDLATKLLDSWKDLKEVYRIPKKSQTEKESTITERGRDAVGFR
DQTVAPKTPNRSRERDPDKQTQIKEKRKRRGSLSPPSSAYERGTKRPDDRYDTPTSKKKV
RIKDRNKLSTEERRKLFEQEVAQREAQKQQQQMQNLGMTSPLPYDSLGYNAPHHPFAGYP
PGYPMQAYVDPSNPNAGKVLLPTPSMDPVCSPAAYDHSQPLVGHSTEPLAAPPPVPVVPH
VAAPVEVSSSQYVAQSDAVVHQDSSVTVLPVPAPGPVQGQNYSVWDSNQQSVSVQQQYSP
AQSQATIYYQGQACPTVYGVTSPYSQTTPPIVQSYAQPSLQYIQGQQIFTAHPQGVVVQP
TAAVTTIVAPGQPQPLQPPEMVVANNLLDLPPPSPPKPKTIVLPPNWKTARDPEGKIYYY
HVVTRQTQWDPPTWESPGDDASLEHEAEMDLGTPTYDENPMKTSKKPKTAEADTSSELAK
KSKEVFRKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPE
DLECNENVKHKTKEYIKKYMQKFGAVYKPKEDTELE
NT seq 7671 nt NT seq  +upstreamnt  +downstreamnt
atgatttattttttattcttttgcatgctttcttggctggatgacaatagagaagaagaa
aatgaggcaaagattgaaaatgtgccgaaaacaggtttcatcaaaggaccaatgttcaaa
ggtgttgcttctagtcggtttttgcccaaaggcaccaagacaaaagttaatttggaggaa
cagggacgacagaaggtgtcattcagcttcagccttacaaagaaaactttgcagaacagg
tttctgactgcacttggcaatgaaaagcaaaatgatactccaaattccccagttgtacct
cttcaagtagactcgacccctaaagttaagacggacattggagatacattatctactaca
gaagaatcttcaccaccgaaatcaagggtagaattgggcaaaatccattttaagaaacat
ctgcttcatgtaacatccaggccactgctgactgctaccacagcagtggcatctctgtct
cctcccatggcaccgttaccagcagtcatagcagaatcaacaactgtagactcgccaccc
tcatctccacctccaccacctccacctccacaagccacaacaccctcatcaccagcacca
gtaacagagccagtggccttgccacacacaccagttgcagttctgatgacagcacccgta
gatgtagctgctagagccttgaaggagccaccagtaacagttgtaccagaatcatcagaa
gtggacactaaacaggaccttgtatctaatagttcagaagaacacataactcacagtttg
catgagcaggcagatattccttcacaaaaagaagattcccatattgggaaggaagaagaa
actccagatagttctaagagtagtctgggctctaaaaaaacaggttctaagaagaaatcc
tcacaatctgaaggcacctttcttggttcagaatctgatgaagattctgtacggacttcc
tcaagtcaaagatcacatgatttaaaattttcagcaaacattgacagagaaagagattca
aaaaagagcttagcaacttttaaaagtgaggatttagggaaatcttcacggtctaaaaca
gagagagatgataaatattttagctactcaaaacttgaaagagatactcggtatatatct
tctcgctgtagagagagagaacgaaggaggagcagatctcggtctagatctgacagaggc
tctagaactagtttatcttattctcggtcagaacgatcccattattatgactctgatcgt
cgctaccataggagttccccctatcgagaaaggactcgctattctcgggcatatacagat
agcagggcgagagagagttctgactcagaagatgagtataagaagacatactcaaggcgc
acctcatctcattcttcctcttacagagacctaaggacatcatcatcctattctaaatct
gaccgagactgtaaaactgagtcctcttacttagagattgagaaaagaggaaagtattct
tccaaattagaaagagaatccaaaaggacttcagaaaatgaagcaatgaaaagatgctgt
tctccccccaatgaactcggattccgacgggggtcatcatattccaagcatgataacaat
gcttcccgttacaaatctgccccttcaaaacctgtatccaagtctgataaatttaaaaat
tctttctgttgtacagaattgaatgaggaaaccagacagtctcattcttttagtttacag
actccttgttcaaaaggtagtgaattaagagtgattagtaaaattcctgagagagaaaag
actcggtctccatctccatcaaatcgattaaatgattcacctacttttaaaaagctagat
ggatcgcctgtttttaagtctgaatttataggacatgatagccatgatagtattaaagaa
gtagactctttatgtaaagtgaagaatgatcagttaagaagttattgtcccacagaatta
aatataaatgggtctccaggggcagaatctgatttggcagcattttgcacttctaaacat
gacactgttttgatgtcttctgatgatagtgtgactggatcagaggtatccccctcggtc
aaaacatgcatgctttcatcaaatggatttcaaaatactaatagatttaaagaaaaagac
ttggatgatacttgcatgaagcatagtaagtcagaaagcgcatctagagaaacagaacct
ctggtgtcaccacaccaagatcaactcatttctttgccagttataactatagattattcc
aaaacagttgttaaagaaccagttgaggtgagagtttcttgctgtaaaaccaaagattca
gatatatactgtacttcaaatgacaaccacacttcttcatgtcattctggagctgaaaat
actgagcctttagtctcgaagatgtcttcaaatagctttatgaatgtgcatttgaaatca
aaaacagttatatgtgataatggaaatctaaccgatcagcactcaaaatttgcatgtgga
gaatataagcagagtgttggtagtactagctcagcttctgttaatcattttgatgattta
tatcaaactccagggagctcatgtatcgcttcatctcttcagagtcttcccccaggaatg
aaagtgaacagtttaactctcttgcaacgtggagagaatatatctccagttttggatgct
gtgctgaagagtaaaaactcagagtttttaaagcatgcagagaaagaaacggtaatagaa
gtaggtggtgaccttcctgattcaggaaggggatttgcttcatgggatagcaggcataat
aatggactgtctgagaaatgtgtgcaggaggctcatgaagaagggaattctttattgcct
gatagaagaggaagaccagagatctctttagatgaagaaggtggaagaggacatgcacat
atttctgatgactcagaagttgtattttcttcttgtgatttgaatttaactatggaggac
agtgatggcgtaacatataccttaaaatgtgacagtagtggtcatgcctcagagattgta
tctactgtccatgaagattattctggttcttccgaaagttcaagtgatgaaagtgattca
gaggatacagattctgatgatagcagtattccaagaaaccgtcttcagtctgttgtggtt
gtgccaaagaattctactttgaccatggaagaaactagtccttgttcttctcggagcagt
cagagttacagacactattctgatcactgggaagatgagagattggagccaaggagacat
tcatacgaggaaaaatttgagagtataacaagtaaatcctgtcctcaaactgagaagttc
ttctttcataaagcagcagagaaaaactctgaaatttcttttatacagcccagccgaaaa
cagatagataatcacctgcctgaaattgctcatcctcagagtgatggggttgatagtaca
agtcatccagacataaaatccgaccctctagggcattcaaattctgaggaaatggtgaaa
actaaaatagcttctcagcagcaagaagagctaccagtttattcttctgatgattttgaa
gatgtctcaagtaagtctcggcaacagactgcttttccgatcagggcagatagtcgactg
gggaaaacagattcaagcttttcttcttcttatgagatctcccgcatggatggcgtccgc
tcatcagaggagctcagaaacctagggtgggacttctctcaacaagaaaagcctaccagc
acataccagcagcctgacagcagctatggagcctgtggcggacacaagcatcagcaaagt
gcagaacagtgtagcggggtgcgcagttactggcaaggcaacggctactgggatccaagg
tcagcgagtagaccgccaggagctgggcttgtgtatgatcgagttcaagggcaggtacca
gattccttaacagatgaccgagaagaggaggagaattgggatcaacgtggaggatctcac
ttttctagtcagtccagtaagttttttctgtcccttcagaaggacaagggttcagtgcaa
gcgcctgaaataagcagcaattccattaaggactctttggctgtgaatgagaagaaagat
cttctgaaaaacttagacagaaatgatatgaaagatagaggacctcttaaaaaaagaaga
caggagttggagagtgattctgaaagtgatggtgagcttcaggacagaaagaaagttcga
gtggagatagagcagggagagacagcagtgcccctcggctcagcgctggttgggccttcc
tgtgtcatggaggacttcagggacccccagcggtggaaggaatatgccaagcaagggaag
atgccttgttactttgatctgattgaagaaaatgtttatttaacagaaagaaagaagaat
aaatcccatcgggatattaagcgaatgcagtgtgagtgtacacctctttctaaagatgaa
agagctcaaggtgaaatagcctgtggggaagattgtcttaatcgtcttctcatgattgaa
tgttcttctcggtgtccaaatggggattattgttccaatagacggtttcagaggaaacag
catgcagatgtggaagtcatcctcacagaaaagaaaggctggggcttgagagctgctaaa
gaccttccttcgaacacctttgtcctggaatattgtggagaggtacttgatcataaagag
tttaaagcccgggtaaaggagtatgcacgaaacaaaaacatccactactatttcatggcc
ctgaagaatgatgagataatagatgccactcagaaaggaaattgctcccggttcatgaat
cacagctgtgaaccgaactgtgagactcaaaaatggactgtgaatggacaactgagagtt
gggttttttaccaccaaactggttccttcaggctcagagttaacatttgactatcagttc
caaagatatgggaaagaagcacagaagtgtttctgtgggtcagctaattgccggggctac
ctgggaggagagaacagagtcagcatcagagcagcaggagggaaaatgaaaaaagaacga
tctcgtaagaaggattcagtggatggggagctagaagctttgatggagaatggcgagggt
ctctctgataaaaaccaagtgctcagcttatcccggctaatggttagaattgaaactttg
gaacagaaacttacctgtctcaagctcatacagaacacacactcacagtcttgcctgaag
tcctttctggaacgtcacgggttgtctttgttgtggatctggatggcagaactaggtgat
ggccgggaaagtaaccagaagcttcaggaagagattataaagactctggaacatttacct
attcctactaaaaatatgttggaggaaagcaaagtacttcctattattcaacgttggtct
caaaccaagactgctatccctcagctgagtgaaggagatgggtattctagtgaaaataca
tcacgtgctcacacaccgctcaacacacctgatccttccaccaagctgaatgcagaagct
gacacagacacccccaagaagctcatgtttcgcagacttaaaattataagtgaaaatagc
atggacagtgcaatctctgatgctaccagcgagctggaaggcaaggacgggaaagaggac
ctggaccagttagagaatgtccccatcgaagaagaggaggagcctcagccgcagcagcta
ctcgtgcagcagctgcccgagcctaaagtcgacagtgacattgccgcagaggccagcaag
ctccccacgtccgaactggaggctgatgctgaaatagaacacaaagagagcagtggcgca
aaactcgacgaacctattgctgaggaaacgccatcccaagatgaagaggagggtgtatct
gatgtggagagtgagagaagtcaggaaccaccagacaaaacagtagatataagtgatttg
gccaccaagctcctggacagttggaaagacctaaaggaggtatatcgaattccgaagaaa
agtcaaactgaaaaggagagcacaataaccgaacgaggaagggatgctgtaggcttcaga
gatcaaacagttgccccaaagactcctaacaggtcgagagagagagacccagacaaacaa
actcaaattaaagagaaaaggaaacgaaggggctccctctcaccaccttcttctgcctat
gagcggggaaccaaaaggccagatgacagatatgatacacctacttctaaaaagaaagta
cgaattaaagatcgcaataaactttctacagaggagcgtcggaagttgtttgagcaagag
gtcgctcagcgggaggctcagaaacagcagcagcagatgcagaacctgggaatgacgtct
ccactgccctatgactctcttggctacaatgcccctcatcacccctttgccggctaccca
ccaggttatcccatgcaggcctatgtggatcccagcaatccaaatgctggaaaggtgctc
ctccccacacccagcatggaccctgtgtgttctcctgctgcttatgatcactctcagccc
ttggtgggacattctacagaacccctcgctgcccctccacctgtgccagtggtgccacat
gtggcagcccctgtggaagtttccagttcacagtatgtggcccaaagtgacgctgtggta
caccaagactccagtgtcactgtcttgccagtgccagccccaggcccagtccaaggacag
aattacagtgtctgggattcaaaccaacaatccgtgagcgtacagcagcagtactctcct
gcacagtctcaagcaaccatatattaccaaggacaggcttgtccaactgtctatggtgtg
acgtcaccctattcacagacaactccaccaattgtgcagagttatgcccagccaagtctt
cagtacatccagggacaacagattttcacagctcacccacaaggagtggtggtacagcca
actgcagccgtgactacaatagttgcaccagggcagccccagcccttacagccacctgaa
atggttgtggcaaataatctcctggatttaccacccccatctcctcccaaaccaaaaacc
attgtcttacctcccaactggaagacagcccgagacccggaaggcaagatttactactac
cacgtggtcaccaggcagactcagtgggatcctcctacttgggaaagcccaggagatgat
gccagccttgagcatgaagctgagatggacttggggaccccgacatatgatgaaaatccc
atgaagacctcaaaaaagcctaagacagcagaagcagacacctccagtgagctggctaag
aaaagcaaagaagtattcagaaaagagatgtcgcagttcatcgtccagtgcctgaaccct
taccggaaacctgactgcaaagtgggaagaattaccacaaccgaagacttcaaacaccta
gctcgcaagctgactcatggcgttatgaataaggagctgaagtactgtaagaaccccgag
gacctggagtgcaatgagaatgtgaaacacaaaaccaaggagtacattaagaagtacatg
cagaagtttggggctgtttacaaacccaaagaggacactgaattagagtga

DBGET integrated database retrieval system