KEGG   Ovis aries (sheep): 101115136Help
Entry
101115136         CDS       T03117                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn] isoform X1
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
oas  Ovis aries (sheep)
Pathway
Peroxisome
Longevity regulating pathway - multiple species
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Prion diseases
Brite
KEGG Orthology (KO) [BR:oas00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    101115136
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    101115136
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    101115136
   05016 Huntington's disease
    101115136
   05020 Prion diseases
    101115136
Enzymes [BR:oas01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     101115136
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
11
AA seq 184 aa AA seqDB search
MGFASACVLRRFLVCLVGVSLAVRAGEPFPRVMATKAVCVLKGDGPVQGTIRFEAKGDKV
VVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVKA
DKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGGRLACGVI
GIAP
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgggttttgcgtcggcgtgtgttctgcggcgtttccttgtctgcttggtgggggtgtct
ctagcggtccgggccggagagcctttcccccgagtcatggcgacgaaggccgtctgcgtg
ctgaagggtgacggcccggtgcaaggcaccatccgcttcgaggcaaagggagataaagtc
gtcgtaactggatccattacagggctgactgaaggtgatcatggattccacgtccatcag
tttggagacaatacacaaggctgtaccagtgcaggccctcactttaatcctctgtccaaa
aaacacggtgggccaaaggatgaagagaggcatgttggagacctgggcaatgtgaaggct
gacaaaaatggtgttgccattgtggatatcgtagatcccttgatctcactctcaggagaa
tattccatcattggccgcacgatggtggtccatgaaaaaccagatgacttgggcagaggt
ggaaatgaagaaagtacaaagactggaaacgctggaggtcgtttggcctgtggtgtaatt
ggaattgccccgtaa

DBGET integrated database retrieval system