KEGG   Octopus bimaculoides: 106873585Help
Entry
106873585         CDS       T04127                                 

Definition
(RefSeq) histone-lysine N-methyltransferase eggless-like
  KO
K11421  
histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
obi  Octopus bimaculoides
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:obi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    106873585
Enzymes [BR:obi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     106873585
Chromosome [BR:obi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     106873585
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    106873585
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 1412 aa AA seqDB search
MTSLATFSDSDEVGKDQVDEEEMEVEKDADADANDNSKPDQDTQETSKEEKPSKLSEKSG
SDSVISNIKKDDDRDVTSSETEIAEKKVTIKVEAKSEDTGSDGDNDICSSADTTKKADTN
GNKQMQEAVKDFEGKKRRENTLKSLDDRDISDQKKPRILDTKKVEHSNTSDNEEEEEEDM
AAAESPKADDKEMMKMEDVEKGSKKKLKTESDDNENSMEVDEPSVVGTIKEEDESGCRGL
DKKITVKQEVRNVKEEVTASKEEVGAMKEGKNGIKEELDVSSFKKQLKEEDVKDIKLVNG
IKKPETIYKLSFDAEKFISNQISKMDLDQANLTKLNGMNCQLKATERKQREISKIFSDCT
NLLAKFRATLEATEAIESEEKVGGNVETVEISDDDEVEFIETTFEPDLVANRPHQQSATN
PSMNNASNMDSLRAALTEALNKQMPSQVNQSLHKPFSDEDRKLFDISVGSKVLAKKLNDI
WYKGIVQEVSQKERSKKFKIKFDGKGTKVLGAKHVAFYENWNIPIKVGSRVVGNKSSMYR
DEEANPSTSFYAGIVAEVPTNRNRHRFLIFFDDGYAQYCLPKEIHRVYEQSKNVWEDIHP
DSQEFIKEYLAQYPERPMVQLQKNQVVKTEWMGEWWTAKVVEVDASLVKMYFSADKRTEW
IYRGSTRLEPLFSALARAETNKLTGFKNKRQRLVAASRGNKPVVEYTRAQTVEIDDEDTH
ITNKVSRTQHGPDQKKRSVAKKSTTSHNSQNGTGANSWEAPWLKMQRNPKSSSASAEKKR
EQYQTSSISSHKQGRDMASVLQERLAAQTDGDLDEDALGERIDIDNIISPRNMLRKKLIP
HECSPECVKDCDDKDFHIKFRGRNMLLVPTLCGWERQVTKVRPSAKRIVIYRGPCARRMR
NLDEVDKYLLATNCNLSIDLFTFDPNLHTHTEFVPIKTFCDIKDISYGKENVPVSCVNGI
DRQYPAYVEYSTKRYPAKGVHLNLDEEFLISCDCTDGCRDRTKCACIQMTIEATTASPGG
HADESVGYKYRRLNEPILTGIYECSSRCKCDYRCFNKVAQNGLQLRLQVFKTEKRGWGLR
CLDDIPTGGFICIYAGQLLTEQGANEDGQQYGDEYLAELDYIEVVEKHKEGYESEVVDLD
DAESTSYSSLSSNSSRSSNTADQDHSDKKTTENGSEEKLGKLVLKREANKDKEWSVKIQG
SSQRTADWVDSLNNEPIVIDDDEDEEEDNTQTTKSDSSAATPIPATKRGNIFTILEEKKE
PTPNADELPDLEEKLPGLGLRKCTRSTTRSRFKNLPNPKDGKNPSKERIEEREQRPSTRY
YFNDGQLCYVMDAKSMGNLGRFLNHSCSPNVFVQNVFVDTHDLRFPWVAFFAGQYIRAGT
ELTWDYNYEVGSVPGKILYCYCSSAECRGRLL
NT seq 4239 nt NT seq  +upstreamnt  +downstreamnt
atgacatcacttgcgacattttccgactctgatgaagtaggcaaagatcaagttgatgaa
gaagagatggaagttgagaaagatgcagatgctgatgcaaatgacaacagcaaaccagat
caagatacacaggaaacatcaaaggaagaaaaaccttctaaattatcagagaaaagtggc
agtgatagtgtaattagtaacattaaaaaggatgatgacagagatgtaacgagttcagag
actgaaattgctgaaaagaaggtgactattaaagtggaagcaaaaagtgaagacacaggc
tccgatggggataatgatatttgttcttctgctgacacaacgaagaaggctgatacaaat
ggaaataagcaaatgcaagaagctgtgaaggattttgagggtaagaagcgcagagagaac
actctgaagtcgctggatgacagagacatttctgaccaaaagaaaccacgtattcttgat
accaaaaaagttgaacattcaaatacgagtgacaatgaagaagaggaggaggaggatatg
gcagctgctgaaagccctaaagctgatgataaagagatgatgaagatggaggatgtggag
aaaggaagtaagaaaaagttaaagaccgagagtgatgataatgaaaattctatggaagtt
gatgaaccaagtgttgtaggaacaataaaagaagaggatgagagtggctgccggggttta
gataagaaaattactgtgaaacaagaagtaagaaatgtaaaagaggaggttacagcatcg
aaagaagaggttggtgctatgaaagaagggaagaacggtatcaaagaagaattagatgtg
agtagttttaagaaacaattaaaagaggaagatgtgaaagatataaaacttgtgaatggt
atcaagaaaccagaaactatctacaagctgagttttgatgccgaaaagtttatttcaaat
caaatttccaaaatggatcttgaccaggcaaatttgacaaaacttaatggaatgaactgt
caactgaaagccacagaaagaaaacagagagaaattagcaaaatcttttctgattgtact
aacctcttagccaaattccgtgctacactggaagcaactgaagccatagaatctgaagag
aaagttggcggcaatgtggaaacagtagaaatcagtgacgacgatgaagtggaattcatc
gaaaccacttttgaacctgaccttgttgccaaccgaccgcatcagcagtcagcaacaaat
ccttccatgaacaatgcttccaacatggactcactgagagcagcactaacagaagcactg
aacaaacagatgccttctcaggtcaatcagtctttacacaagccattctctgacgaggac
cgtaaactgttcgatatcagtgttggcagtaaggtacttgctaaaaagttgaatgatatc
tggtataaaggtattgttcaggaagtaagccaaaaagaacgatcgaaaaaatttaaaata
aaatttgatgggaaaggcactaaagttcttggtgctaaacatgttgctttttatgagaac
tggaacattcctatcaaagttggtagcagagtagttggaaacaaaagttcaatgtatcga
gatgaagaagctaacccttcaacatctttctatgccggtatcgtggcagaagtgccaacc
aaccgaaatcgccacaggttcctgatattttttgatgatggctacgcccagtattgcctc
cccaaagagatacaccgtgtctatgaacagagcaaaaatgtttgggaagatatccatcct
gactctcaagaatttatcaaggaatatttggcccagtatccagaacgaccaatggtgcag
cttcagaaaaaccaagttgtcaaaacggagtggatgggagaatggtggacagctaaagtg
gtcgaagttgatgccagtttagtgaaaatgtatttttctgctgataaaagaacagaatgg
atttacagaggatcaacaagattggaaccgctcttttcagctttggcccgggctgagacg
aacaagttgaccggttttaagaacaagcgacaacgccttgtagctgcttccagaggcaat
aaaccagttgtagaatatactcgtgcccaaacagtagagattgatgatgaagacacacac
attacaaataaagtctccagaacccaacatggacctgaccagaagaagaggtcagttgct
aagaaaagcacaacatctcacaatagtcaaaatggaactggtgcaaactcttgggaagca
ccttggctgaagatgcaacgaaatccaaaatcaagcagtgcatcagccgaaaagaaaaga
gaacaataccagaccagcagtattagtagccacaaacaaggaagggacatggcaagtgtc
ctccaagagagattggctgcacagacagatggagatcttgatgaagatgcccttggggag
agaattgacattgataacattatttctcctcggaacatgttgagaaagaaactcattcca
catgaatgttctcctgaatgtgtaaaagattgcgatgacaaagattttcacatcaaattc
cgtggccgtaacatgttgcttgttcctactttgtgtggttgggagaggcaagtgaccaaa
gtacgacccagtgccaaaagaatagtgatctacaggggtccctgtgcacgacggatgcgt
aatttggatgaagtcgacaaatatttattagcaactaattgtaatttgtctattgattta
ttcacttttgatcccaacctccacacccatactgaatttgtacctatcaagactttctgt
gatatcaaagatatttcatatggtaaagaaaatgttccagtgtcttgtgtgaatggtatc
gatcggcagtatcctgcctatgtagaatattccactaagcggtatcctgccaaaggagta
catctcaatttagacgaggaatttttgattagctgtgattgtaccgatggctgtcgggac
agaactaaatgtgcatgtattcagatgacaattgaagccactacagccagtcctggtggc
catgcagatgagtctgtcggctataagtatcgacgtttgaatgaaccaattttaacaggc
atttatgagtgcagcagccgatgtaaatgtgactacaggtgtttcaacaaagttgcacag
aatggcctgcagttgcgactgcaagtattcaaaacagaaaaacgaggctggggtctgcgc
tgcttagacgatattccaactggtggctttatttgtatttatgctggtcagttgttgaca
gaacaaggagccaatgaggatggccagcagtatggagacgaatatcttgcagagcttgac
tacattgaagtggttgaaaaacacaaagaaggttatgaaagtgaagttgttgatctcgat
gatgcagagagtacctcctactcttcactctcatccaatagcagcagatcttcaaacact
gcagatcaggaccattctgataagaagacaactgaaaatggcagtgaagaaaagctggga
aaactagtgttaaagagagaagccaacaaagacaaagaatggtctgtgaaaatacaaggt
tcgtctcagcgtactgctgattgggtggacagtttgaataacgaaccgattgttattgat
gatgatgaagatgaagaagaggataatacacaaacgaccaagtctgactcatcagctgca
accccaattccagccacaaagagaggcaacatcttcactattttagaagagaagaaagaa
ccaacgccaaacgctgatgaattgccagatttggaagaaaagcttcctggtcttggtctt
cgcaaatgtaccagatctacaacaaggtccagattcaagaaccttccaaaccccaaagat
ggaaagaacccgagcaaagagaggattgaagaaagggagcaacgtcccagcactcgttac
tacttcaatgatggtcagctgtgctatgtgatggatgccaaatcaatgggaaatctcggc
cgtttcctcaatcacagttgttctccaaatgttttcgttcaaaacgtgtttgttgacaca
catgaccttcggttcccctgggtggcattctttgctggacagtacattcgcgcaggaacg
gaactgacatgggattataactacgaagttggcagtgttccgggcaaaatcctttattgc
tattgcagttcagctgaatgtcgaggtcggctcttgtag

DBGET integrated database retrieval system