KEGG   Octopus bimaculoides: 106875752Help
Entry
106875752         CDS       T04127                                 

Definition
(RefSeq) serine-rich adhesin for platelets-like
  KO
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
obi  Octopus bimaculoides
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:obi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    106875752
Enzymes [BR:obi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     106875752
Chromosome [BR:obi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     106875752
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 1206 aa AA seqDB search
MVVEGGSSRYSPSTGMTAKELCENDDLATSLILDPYLGFITHKMNTKHKPLRGRQEELTA
LVEKFMKDQCYEDTYAKFLCEDVVRNFLIGKSKENRRIFREHVYRYLRMFDKDAGFKLIP
CYRYKCDGQVGGKICSTRKWRKQNRVPMLVGCIAELTKLEEEQLLKPGLNDFSVMFSCRK
NCAQLWLGPASFINHDCRPNCKFVSTGRDTACVEVLRDIESNEEITCYYGEDFFGDKNCL
CECVTCERRKKGAFQVKDPPGSPELDQGYKFRDTNDRINRMKNQALQSKMSIRVNEAYIS
GNENWDFRSTNLKKNGHLLKSAELKKRGITRYDAEILLSQGINLPEPKVVLERQLPVSIN
GSRSVNLSEAMHRDQRNARRKRAKQSPNKSVHKNGCTEVGTAAASSEEMKATPSDGTARI
PDISIADEVPAELSVSSSQQTKETFSSTAIVPSASELSNEQAKTEAFKSDSQSAVLHLNN
SRKPSKLDAADTVSDSCNNGSLTNGNSQFNQDKYQLDCEGAQRENPEIELVPPSLALPSV
TLQQETKQGQTLSALVLNGEDNTKIELKTALESKISPLVPAKNICQKDFYPTTNENSQKL
ETPSKISCLTNGDTAEKLGGQSDCLRPNQLTINSKNDCWKSLTDSEIAASTHSMANLQVS
DVSMDSTAIYNQDKKPFINKSKQSISLKNNTTVRSSPRLRQKPFDQNSSDGHDDETSSKM
NGEVLSDVLDSPSKRTKSTDTENMPLETDPIFFPKSIKMELSSPKNIKSEVLSPQGDSEQ
NVIPSFPPLLSKIKVECFPPKISHTDTLFPSSPTNTESISVPKIKREDNPFLYYTSENIA
KSPQAAKLSSQFSEKTCNSLSNKILLSTPCHKAPSAPSSQKHSQSDEVFKHSFLQSKIQS
TPPHLNYIHAAADVSAGLQRTSKIEASQFSEKPSGLVPSPQSDVLPSPVQTTKFDLINQS
VPKVCVNLLDKFSETSPTSYTLLNTPGSLKLRIRDPSIKSSFPEITRKMFNQQCKKSSPI
AAAGSKHHKLTNTKRKHSLPRCHTRYDSSLETESQYKIPKLTIRMRRDPILEEHLSSNQS
NCVLFDLEDSSSSSSSLSSSSSSSTSSSSSSSSSSSAPREAHCDRSSSSSSSHKHRRHHR
NSSSSSSSNISKHTEHSYLATQKQTKSTLDYHYQSCRPIQTTPKKLRLKLRDCAFELHIP
PGSIAE
NT seq 3621 nt NT seq  +upstreamnt  +downstreamnt
atggttgttgaaggaggcagttcccgttatagtccttccacgggtatgacggcaaaagaa
ctgtgtgaaaatgatgatcttgcaactagtttgatacttgacccatatcttggatttatt
actcacaagatgaataccaagcacaagccattaagaggccgtcaagaagaactaactgcc
ctagtggaaaaatttatgaaagatcaatgttatgaagatacttatgcaaagtttctatgt
gaagatgtagttaggaattttcttattggcaaatctaaagaaaaccgtagaattttccga
gagcatgtatatagatatctgagaatgtttgataaagatgctggattcaagttgatacct
tgttatcgatataaatgtgatggacaggttggtgggaaaatttgttctacgagaaaatgg
cggaaacaaaatcgagttcccatgctagttggttgtattgctgaattgactaaacttgaa
gaagaacaactcttgaaacctggtctaaatgattttagtgttatgttttcttgtcgcaag
aactgtgctcaattatggttgggccctgcatcttttattaaccatgattgcagacctaat
tgtaagtttgtgtctactggtcgggatactgcctgtgttgaagtactcagggatattgaa
tctaatgaagaaataacatgttactatggagaagatttctttggtgataaaaactgctta
tgtgagtgtgttacatgtgagaggcgtaaaaaaggtgcttttcaagtaaaagatccacct
ggaagccctgaactggaccaaggttacaaatttcgggatactaatgatcggataaataga
atgaaaaatcaggcacttcagtcaaaaatgtcaattagggtgaatgaggcctatatatct
ggaaatgaaaattgggatttccgttccacaaatctgaaaaaaaatggacacctcttgaag
tctgcagagttgaagaaacgaggtattacacgctatgatgctgagattctcctttctcag
ggtatcaacttgcctgaacctaaagtggtgctggagcgtcagttaccagtctcaatcaat
ggcagtcggtcagttaatttgagtgaagctatgcacagagaccaaaggaatgctagaaga
aaacgagccaaacaaagcccaaataaatcagtccacaagaatgggtgtactgaagttggt
acagctgctgcatcttcagaagaaatgaaagcaacaccatctgatggtactgctcgcatt
cctgatatttctattgctgatgaagtaccagctgagctgtctgtgagttcctcacaacag
acaaaagaaaccttttcttcgactgcgattgttccatctgcatctgaacttagcaatgaa
caagcaaagactgaagctttcaagtcagacagccagtcagctgttctgcatcttaataat
agcaggaagccttctaaattagatgcagcagatactgtcagtgatagttgcaacaacggc
agcctaacaaatgggaattctcagttcaatcaagacaagtatcaacttgattgtgaaggg
gcccaaagggaaaatccagaaatcgaattagttccaccatcacttgcattaccatcagta
acactgcagcaggaaacaaaacagggccaaacactctcagcattagttctcaatggagaa
gacaatactaaaatagaattaaagacagctttagagtcaaaaatttcaccattagttcct
gctaaaaatatatgtcaaaaagatttttacccaaccaccaatgaaaattctcaaaaacta
gaaaccccctccaaaatttcatgcctgactaatggagatactgctgaaaagttgggagga
caatctgattgtttgcgacccaatcagctgaccatcaacagtaagaatgactgctggaag
tcattgactgacagtgagattgcagcttcaacacactccatggccaacctgcaggtcagt
gatgtgtctatggatagtacagcaatctacaatcaagacaagaaaccttttataaacaaa
agcaaacaatctatttctctaaaaaataatactactgtcaggtcaagtcctcgactgcgg
caaaaaccatttgatcaaaattcctctgatggtcatgatgatgaaactagttcaaagatg
aatggagaggttttgtctgatgtactagactctccctcaaaaagaacaaaatccacagat
acagaaaacatgcctcttgaaacggaccctatttttttcccaaagagcatcaagatggaa
ctttcatcacccaaaaatataaaatcagaagtattgtctccccaaggagattcagaacaa
aatgtcataccttcttttcctccacttctttctaagatcaaagttgaatgttttccacct
aaaatctcacacacagatactttatttcctagtagccccactaatacagagagtatctcc
gttccaaaaattaaaagagaagataatcctttcctttattacacttctgaaaacatagcc
aagtctcctcaagcagctaagttgtcttcccagtttagtgaaaaaacatgtaattctcta
agcaacaaaatccttctgtctaccccttgtcataaagcccctagtgcacctagctctcaa
aagcattctcagtctgatgaagtttttaagcattcatttctgcaatctaagattcagtct
actccacctcatcttaattatattcatgcagcagctgatgttagtgctggtttgcagagg
acttctaagatagaagcctctcagttttctgagaagccttctggccttgtgccttcccct
caatctgatgtcctaccatcacctgtgcaaacaacaaaatttgatttaataaatcagtca
gtacctaaagtatgtgtaaatttattagataagttctctgaaaccagcccaacgtcatac
actcttcttaacacaccaggaagtttgaaactgcgcattcgtgaccctagtataaaatct
agcttccctgaaataactcgaaaaatgttcaaccaacagtgtaaaaaaagcagtcctata
gcagctgcagggagcaaacaccacaaattgactaatacaaaacgcaagcattcactgcct
cgttgccatacgcgatatgatagcagcctggaaactgaatcacaatataagattcctaaa
ttgactatccgcatgcgtcgagacccaatcctggaggaacacctatcttccaatcaatca
aactgtgtcctctttgatctagaggattcatcatcatcctcatcatcattatcatcatcc
tcgtcctcatccacatcatcatcttcgtcatcatcatcatcatcttccgcacctcgggaa
gcacattgtgataggtcctcctcttcatcttcttcacacaaacacagacgccatcacaga
aacagtagcagcagcagcagcagtaacatttcaaaacacactgaacattcctatctggca
actcaaaaacaaaccaagtcaacccttgattaccactaccagtcgtgccggccaatccaa
acaacaccaaaaaagttacggttaaaattacgagattgtgcatttgagctccacatccca
cctggtagtatagcagaataa

DBGET integrated database retrieval system