KEGG   Oryza brachyantha (malo sina): 102707738Help
Entry
102707738         CDS       T02995                                 

Definition
(RefSeq) hexokinase-6
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:obr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102707738
   00051 Fructose and mannose metabolism
    102707738
   00052 Galactose metabolism
    102707738
   00500 Starch and sucrose metabolism
    102707738
   00520 Amino sugar and nucleotide sugar metabolism
    102707738
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    102707738
Enzymes [BR:obr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     102707738
Membrane trafficking [BR:obr04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    102707738
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
1
AA seq 506 aa AA seqDB search
MGKGAVGGTAVVVCAAAAAAVGVAVVVSRRRRSMREAEAERRRKAAAVIEEVEQRFSTPT
ALLRGIADAMVEEMERGLRADPHAPLKMLISYVDNLPTGDEHGLFYALDLGGTNFRVIRV
QLGGREKRVVSQQYEEVAIPPHLMVGTSMELFDFIAAELESFVKTEGEDFHLPEGRQREL
GFTFSFPVHQTSISSGTLIKWTKGFSINGTVGEDVVAELSRAMERQGLDMKVTALVNDTV
GTLAGGRYVDNDVVAAVILGTGTNAAYVEHANAIPKWTGLLPRSGDMVINMEWGNFKSET
LPRSEYDSVLDFESLNPGEQIYEKMISGMYLGEIVRRILLKLAHDASLFGDVVPPKLEQR
FVLRTPDMSAMHHDTSHDLKHLGAKLKDILGVADTSLEARYITLHVCDLVAERGAHLAAA
GIYGILKKLGRDSVPSDGSQKQRTVIALDGGLYEHYKKFRTCLEATLTDLLGDDAASSVV
VKLANDGSGIGAALLAASHSQYASVE
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggggaagggggcggtcggggggacggcggtggtggtgtgcgccgcggccgccgcagcg
gtcggggtggccgttgtggtgtcgcggaggaggaggagcatgcgggaggcggaggcggag
aggcggaggaaggccgccgcggtgatcgaggaggtggagcagaggttctccacgcccacg
gcgctgctgcgcggcatcgcggacgccatggtggaggagatggagcgcgggctccgcgcc
gacccccacgccccgctcaagatgctcatcagctacgtcgacaacctccccaccggggat
gaacatggactgttctatgctctagatcttgggggcaccaatttccgtgtcatacgggtt
cagcttggaggaagggaaaaacgtgttgtctctcaacagtatgaagaggttgcgattcca
cctcacctgatggttgggacttctatggaactgtttgatttcattgcggctgaattggaa
agttttgtcaagactgaaggagaggatttccacttgccagagggcaggcagagagagctg
ggcttcaccttttctttcccagtgcaccaaacatcaatatcgtcaggcactcttattaag
tggacaaagggattttccatcaacggcacggtgggagaagatgttgtagctgaattgagc
agggctatggaaagacaagggcttgatatgaaagttacagctcttgttaatgacactgta
ggcactttggctggcggaagatatgttgataatgatgtagttgctgctgtaatattaggc
actggtacaaatgcagcatacgtggagcatgcgaatgcgattccaaaatggactggacta
ctaccaagatcaggagatatggtgattaacatggaatggggaaacttcaagtcagaaacg
cttcctcgttcagaatatgatagtgtcttggactttgaaagtttgaaccccggcgagcag
atatatgaaaagatgatttctggcatgtatcttggagagattgtgcgcagaatcctgctt
aagctggctcatgacgcttcattatttggggatgttgttccaccaaaactggagcagcgc
tttgtactgaggacgccggacatgtcagcgatgcatcatgatacctcacatgatctgaaa
cacctgggagctaagctgaaggatatcctgggggtcgctgatacttccctggaagcacga
tacatcactcttcatgtctgcgaccttgtcgcagagagaggtgcacatttagctgctgct
ggcatatatggcattctaaagaagttaggcagggacagtgtgccaagtgacggtagtcaa
aagcagaggactgtcattgctctggatggtggtctctatgagcattacaagaagttcaga
acctgcctagaagcaacgcttacagacctgctcggagacgacgctgcctcatcagttgtt
gtcaagttggcaaatgatggctctggcatcggagccgcacttcttgcagcatctcactcc
cagtatgctagcgtcgaatag

DBGET integrated database retrieval system