KEGG   Oryza brachyantha (malo sina): 102717970Help
Entry
102717970         CDS       T02995                                 

Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:obr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    102717970
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102717970
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102717970
   00430 Taurine and hypotaurine metabolism
    102717970
Enzymes [BR:obr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     102717970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3
AA seq 491 aa AA seqDB search
MVLSHGVSGSDESIHSTFASRYVRSSLPRFRMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIQASVNKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGDSETAVG
VGTVGSSEAIMLAGLAFKRRWQNKMKAAGKPCDKPNIVTGANVQVCWEKFARYFEVELKE
VKLSDGYYVMDPAKAVDMVDENTICVAAILGSTLNGEFEDVKLLNDLLTQKNAETGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWCIWRTKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYKNIMENCQENAMVLKRGLEK
TGRFNIVSKDNGVPLVAFSLKDSSRHNEFEISDFLRRFGWIVPAYTMPPDAQHVTVLRVV
IREDFSRTLAERLVLDVEKVLHELDALPARVALNGDALAAAASEREMEKQREVISLWKRA
VLSKKKTNGVC
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggtgctctcacacggcgtgtcgggctccgacgagtccatccactccacgttcgcctcc
cgctacgtccgatcctccctccccaggttccggatgccggagaactcgatcccgaaggag
gcggcgtaccagatcatcaacgacgagctgatgctggacggcaacccgcggctgaacctg
gcgtcgttcgtcaccacgtggatggagcccgagtgcgacaagctcatccaggcctccgtc
aacaagaactacgtcgacatggacgagtaccccgtcaccaccgagctccagaaccgatgt
gtgaacatgattgcacacctcttcaatgcccctctaggagactctgaaacggccgtcggc
gtcggcactgtcggctcatctgaggccatcatgctcgccggtttggccttcaagaggagg
tggcagaacaagatgaaggcagctggcaagccgtgcgacaagccaaacattgtcaccggt
gccaatgtccaagtttgctgggagaagttcgcgcgctacttcgaggtggagctcaaggaa
gtgaagctgagtgacggctactacgtcatggacccggctaaggctgtggacatggtcgat
gagaacaccatctgcgttgcggcgatcctcgggtcgacgctgaacggggagttcgaggat
gtcaagctgctcaacgatctgctcacccagaagaacgctgaaacaggctgggacacgccg
atccacgtcgacgcggcgagcggcgggttcatcgcgccgtttctgtacccggagctggag
tgggacttccgtctgccgctggtgaagagcatcaacgtgagtgggcacaagtacggcctt
gtctacgccggtatcgggtggtgcatctggaggaccaaggaggacctgcctgaggagctc
atcttccacatcaactacctcggcgccgaccagcccaccttcaccctcaacttctccaaa
ggttccagccaggtcattgcacagtattaccagctaatccgccttggctttgaggggtac
aagaacatcatggagaactgccaggagaacgcgatggtgctgaagcgtgggctggagaag
acggggcggttcaacatcgtgtccaaggacaacggcgtgccgctggtggccttctcgctc
aaggacagcagccggcacaacgagttcgagatctccgacttcctccgccgcttcggctgg
atcgtgccggcctacaccatgccccccgacgcgcagcacgtcacggtgctccgcgtcgtc
atccgcgaggacttcagccgcacgctcgccgagcgcctcgtgctcgacgtcgagaaggtg
ctccacgagctcgacgcgctcccggcccgcgtcgcccttaacggcgacgccctcgccgcc
gcggcgagcgagagggagatggagaagcagcgcgaggtgatctccctctggaagagggcc
gtgctgtccaagaagaagaccaacggcgtctgctga

DBGET integrated database retrieval system