KEGG   Oryza brachyantha (malo sina): 102720338Help
Entry
102720338         CDS       T02995                                 

Definition
(RefSeq) histone deacetylase 2
  KO
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
obr  Oryza brachyantha (malo sina)
Brite
Enzymes [BR:obr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102720338
Chromosome [BR:obr03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class IV HDACs
     102720338
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
6
AA seq 444 aa AA seqDB search
MQIWKLPSTGSQISHLRILPSSGDVAGLFGYSSPPRRGDSSPPQPRPSPLLLLPAAAAAD
GLFCVVRGGDPGRAAPPRPRPHPLQQALLRRPGLQGSGGLLAGVRHLLPRNREAVSCLPA
RVYARVVSVASLRVRARARGTSLWLCRHPFDSSKWGRICRFLTKEGHLEKNRVVEPLEAS
KDDLLVVHSESYLNSLKSSLKVASIVEVPPVALIPNWLVQQKLLYPFRKQVGGSILSAKL
ALERGWAINVGGGFHHCSAEEGGGFCAYADISLCIQFAFVRLNVSRVMIIDLDAHQGNGH
EKDFANDGRVYTLDMYNAGIYPFDHVAKRYIDQKVELASGTKTDDYLDQLDKAFKASKSR
FQPQLIVYNAGTDILDGDPLGRLKISPEGVVIRDEKVFRFAKDQNIPLLMLTSGGYMKSS
ARVIADSIINLSNKNLIELGNQLG
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatctggaaactaccaagtactggatcacaaatatcacatctacgaatccttccg
agctccggcgacgtggccggcctattcggctattcctctcctccgcggcgcggcgattcg
tctcctccgcaacctcgcccgagcccccttctcctcctcccggcggcggcggcggcggat
ggcctcttctgcgtcgtccgcggcggcgaccccggcagagccgccccgccgcgcccgcga
ccgcatcctctccagcaagctctacttcgacgtcccgggctccaaggctccggtggtcta
ctcgccggcgtacgacatctccttcctcggaatcgagaagctgtgagctgcctacctgcc
cgcgtatatgcgcgcgtcgtctctgttgcctcactgcgcgtgcgcgcgcgcgcgcgcggg
acgtctttgtggttgtgcaggcacccgttcgattcctccaaatggggacgcatatgcagg
ttcctcaccaaggaagggcacctggagaagaaccgagtggtggagccattggaagcatcc
aaggacgatttgctggtggtgcactcagagtcgtacctgaacagcctcaagagcagcctg
aaggttgcctccattgtagaggttcctcctgtagcgcttattcctaattggcttgtgcag
caaaagctactgtaccctttcaggaaacaggttggtgggtccattctatcggccaagctt
gcactagagagaggatgggccattaatgttggtggggggtttcaccattgttctgcagag
gaggggggtgggttttgtgcatatgctgatatttctctctgcattcagtttgcttttgtc
cgtctaaatgtttcaagagtaatgatcatagatctggatgcccaccaaggaaatggccat
gaaaaggattttgctaatgatggaagagtttatacgttggatatgtacaatgctggaata
tatccctttgaccatgttgctaagcggtacattgatcaaaaagttgagctagctagtggg
acaaaaacagatgactacttggatcaacttgataaggcctttaaggcctcaaaaagtaga
tttcagccacagttgattgtttataatgctgggacagatatcctggatggtgatcctttg
ggaagattgaagataagtcccgagggtgtggtgatcagagatgaaaaggtgtttcggttt
gcaaaggatcaaaacatcccactgctcatgctgacatcaggaggctacatgaagtcaagt
gcccgagtgatcgccgattcgataatcaatctctcgaataaaaacttaatagagcttggt
aaccagttgggctaa

DBGET integrated database retrieval system