KEGG   Oligotropha carboxidovorans OM4: OCA4_c11090Help
Entry
OCA4_c11090       CDS       T01967                                 

Gene name
gst
Definition
(GenBank) glutathione S-transferase Gst
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
oco00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:oco00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    OCA4_c11090 (gst)
Enzymes [BR:oco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     OCA4_c11090 (gst)
Transporters [BR:oco02000]
 Other Transporters
  Pores ion channels [TC:1]
   OCA4_c11090 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 Tom37
Motif
Other DBs
NCBI-ProteinID: AEI02252
LinkDB All DBs
Position
1186830..1187450
Genome map
AA seq 206 aa AA seqDB search
MLKLYYGLGTCALASHIALEESGADYVAERLDLKANQQNSPDYLAVNPKGRVPALATDKG
VITETPAILMYIAQSFPKAKLAPFDDPFTFAQAESFNSYICSGMHIAHAHRMRGRRWASE
ESSFEDMRRKVPENIRAGFDLIETKMMRGPWVMGEAYSICDPYLFTIAGWAKSDSVDIAD
FPKVADHYRRMKERPAVQKVLAQYKA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagctttactacggcctcggcacatgcgcgcttgcctcgcatatcgcactcgaa
gaatccggcgcggattacgttgccgagcggctcgatctcaaggcgaaccagcagaacagc
ccggactacctcgcggtcaatcccaagggacgcgtcccggcgctcgcgaccgataaaggc
gtgatcaccgagaccccggcgatcctgatgtatatcgcgcagagttttccgaaggcgaag
ctcgcgccgttcgatgatccgttcacgttcgcgcaggcggagtcgttcaacagctacatc
tgctcgggcatgcacatcgcccatgcgcaccggatgcgcggccggcgctgggcgagcgaa
gagtcctcattcgaggatatgcgccgcaaggtgcctgaaaatatccgtgccgggttcgac
cttatcgaaaccaaaatgatgcgcggtccttgggtgatgggcgaggcctattcgatctgc
gatccgtatcttttcaccatcgctgggtgggccaagagcgacagcgtcgatattgccgac
ttcccgaaggtcgctgatcactaccggcgcatgaaggagcgtccggccgtgcagaaagtg
ctcgcgcaatacaaggcctga

DBGET integrated database retrieval system