KEGG   Oryctolagus cuniculus (rabbit): 100009118Help
Entry
100009118         CDS       T03373                                 

Gene name
TGM1
Definition
(RefSeq) transglutaminase 1
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Brite
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100009118 (TGM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
17
AA seq 834 aa AA seqDB search
MDGPRSDMGRSDVSRSDMSRSDMGRSDMGRSDVGRWRGGPLQPSATPSPEPEPEPEPDRG
SRSRGGRGRSFWARCCGCCSCRNAADDDWGREPSGSRDRGSSSRGGRPDSRGGGVNAAGD
GTIREGMLVVTGVDLLSSRSDQNRREHHTDEFEYEELIVRRGQPFHLVLFLSRPYESSDR
IALELQIGNNPEVGKGTHVIIPVGKGNSGGWKAQVTKASGQTLNLRVHSPASAIIGKFQF
TVRTRTEAGEFQLPFDPRNEIYILFNPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTEAQ
IGERTWNYGQFDHGVLDACLYILDRRGMPYGGRGDPVSVSRVISAMVNSLDDNGVLIGNW
SGDYSRGTNPSAWVGSVEILLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFN
SAHDTDTSLTMDIYFDENMKPLEHLNRDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATP
QETSSGIFCCGPCSVESVKNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKA
IGTLIVTKAVRSHMREDITHIYKHPEGSDAERKAVEMAAAHGSKPNVYDSRDSAEDVAMQ
VEAQDAVMGQDLTVSVVLTNRSSSRRTVKLHLYLSVTFYTGVTGSIFKESKKEVVLAAGS
SDSVVMPVAYKEYRPHLVDQGAMLLNVSGHVKESGQVLAKQHTFRVRTPDLSLTLLGAAV
VGQECEVQIVFRNPLPITLTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQTFVPVRPG
PRQLIAXLDSPQLSQVHGVIQVDVAPASGGRGFLHAGGDSYSGETIPMTSRGEA
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atggatggtcctcgctccgacatgggccgctccgacgtgagccgctccgacatgagccgc
tctgacatgggccgatctgacatgggccgctccgacgtaggccgctggcgtgggggaccc
ctgcagccctcagccacgccttcaccagagccggagcccgagcctgagccagacagaggt
tctcgttctcgtggaggacgaggccgttccttctgggctcgctgctgtggctgctgctcc
tgccggaatgcggcagatgacgactgggggcgcgagccctccggctccagggatcggggg
tccagctctcggggcggaaggcctgactcccggggcggcggtgtaaatgcggctggagat
ggcaccatcagagagggcatgctggtggtgaccggtgtggatttgctgagctcccgctcg
gaccagaaccgccgagagcaccacacagatgagtttgagtatgaagagctgattgtgcgc
cgcgggcagcctttccacttagtccttttcctgtcccggccctacgagtcgtccgatcgg
atcgccctggagctgcaaatcggaaacaaccccgaggtgggcaagggcacccacgtgatc
atcccagtaggcaaggggaacagcggaggctggaaggcccaagtgaccaaggccagcggg
cagactctgaacctgcgggtccactcccccgccagcgccatcattggcaaattccagttc
accgtccgcacacgcacagaggcaggggagttccagctgccctttgacccccgcaatgaa
atctacatcctcttcaatccctggtgcccagaggacattgtgtacgtggaccatgaggac
tggcggcaggaatatgtgctgaatgagtctgggagaatttattatgggactgaagcgcag
attggcgagcggacctggaactatggccagtttgaccatggggtgctggatgcctgcctg
tacatcctggaccggcgggggatgccctatggaggccgtggggacccagtcagtgtctcg
cgggtcatctctgccatggtgaactccctggatgacaatggagtcctcattgggaactgg
tctggcgattactctcgaggcaccaacccctcagcatgggtgggcagcgtggagatcctg
cttagctacctccgcaccggctactccgtcccctatggccagtgctgggtctttgctggt
gtgaccaccacagtgctgcgctgcctgggccttgccacccggactgtcaccaacttcaac
tctgcgcacgacacagacacgtccctcaccatggacatctactttgatgagaacatgaag
ccgctagagcacctgaaccgtgactctgtgtggaacttccacgtgtggaatgattgctgg
atgaagaggccagatctgccctcgggcttcgatgggtggcaggttgtggatgccacgccc
caggagaccagcagtggcatcttctgctgcggcccctgctccgtggagtccgtcaagaat
ggcttggtctacatgaagtatgacacgcccttcatcttcgctgaggtgaatagtgacaag
gtgtactggcagcggcaggacgatggcagcttcaagattgtgtacgtggaggagaaggcc
attggcacactcatcgtcaccaaggctgtgagatcccacatgcgagaggacatcacccac
atctataagcacccagaaggctcggatgcagagcggaaggcagtggagatggcagctgcc
catggcagcaaacccaatgtgtacgactcccgggactctgcggaggatgtggccatgcag
gtggaagcgcaggacgcagtgatggggcaggacctgacggtctctgtggtgctgaccaat
cgcagcagcagccgccgcacggtgaagctgcacctctacctctctgtcaccttctacacc
ggtgtcaccggctccatcttcaaggaatccaagaaggaagtggtgctggcagcagggtcc
tcggacagcgtggtcatgcctgtggcctacaaggagtaccggccacacctcgtggaccag
ggggccatgctgctcaatgtctcaggccacgtcaaggagagtggccaggtgctggccaag
cagcacacattccgcgtgcgcaccccagatctctccctcacgttattgggagcggccgtg
gtcggccaggagtgcgaagtccagatcgtcttcaggaacccactgcccatcaccctcacc
aacgtcgtcttccggctcgagggctctggcttgcagagacccaagatcctcaacgtgggg
gacatcgggggcaatgagacagtgacactgcgccagacgttcgtgccggtgcgaccagga
ccccgccagctcattgccnagctggacagcccgcagctctctcaggtgcatggcgtcatc
caggtggacgtggccccagcctccgggggcaggggcttcctacacgctggaggtgacagt
tactcgggagagaccatccctatgacgtctcgaggcgaagcttag

DBGET integrated database retrieval system