KEGG   Oryctolagus cuniculus (rabbit): 100009407Help
Entry
100009407         CDS       T03373                                 

Gene name
PTGS1, COX-1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00590  Arachidonic acid metabolism
ocu01100  Metabolic pathways
ocu04611  Platelet activation
ocu04726  Serotonergic synapse
ocu04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:ocu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100009407 (PTGS1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100009407 (PTGS1)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100009407 (PTGS1)
  Nervous system
   04726 Serotonergic synapse
    100009407 (PTGS1)
Enzymes [BR:ocu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100009407 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 100009407
NCBI-ProteinID: NP_001076150
Ensembl: ENSOCUG00000002530
UniProt: O97554
LinkDB All DBs
Position
Un
AA seq 606 aa AA seqDB search
MSRSSPSLRLPVLLLLLLLLLLPPPPPVLPADPGAPAPVNPCCYFPCQHQGVCVRVALDR
YQCDCTRTGYSGPNCTVPDLWTWLRSSLRPSPTFVHYLLTHVRWFWEFVNATFIRDTLMR
LVLTVRSNLIPSPPTYNLDYDYISWEAFSNVSYYTRVLPSVPKDCPTPMGTKGKKQLPDA
QVLAHRFLLRRTFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIY
GDSLERQYHLRLFKDGKLKYQVLDGEVYPPSVEEAPVLMHYPRGVPPRSQMAVGQEVFGL
LPGLMLYATLWLREHNRVCDLLKAEHPTWDDEQLFQTTRLILIGETIKIVIEEYVQQLSG
YFLQLKFDPEMLFSVQFQYRNRIAMEFNHLYHWHPLMPDSFQVGSQEYSYEQFLFNTSML
VDYGVEALVDAFSRQSAGRIGGGRNIDHHVLHVAVEVIKESREMRLQPFNEYRKRFGLKP
YASFQELTGETEMAAELEELYGDIDALEFYPGLLLEKCQPNSIFGESMIEIGAPFSLKGL
LGNPICSPEYWKPSTFGGEVGSNLIKTATLKKLVCLNTKTCPYVSFRVPRSSGDDGPAAE
RRSTEL
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgagtcggagcagcccctcgctccggctcccggtgctgctgctgctgctgctgctgctg
ctgctgccgccgccgcccccggttctgcctgcggaccctggggcgcccgcgccagtgaac
ccctgctgttactttccatgccagcaccagggcgtctgtgtccgcgtcgcccttgaccga
taccagtgtgactgcacccgcacgggctactctggccccaactgcaccgtccctgacctc
tggacctggctccggagctccttgcggcccagccccacgttcgtccactacctgctcaca
cacgtgcgctggttctgggagtttgtcaatgccaccttcatccgggacacgctcatgcgc
ctggtcctcacagtgcggtccaacctcatccccagccccccgacctacaacttagattac
gactacatcagctgggaggccttctccaacgtgagctattacacgcgcgttctgccctcc
gtgcccaaagactgccccacgcccatgggcaccaaagggaagaagcagctgccagacgcc
caggtcctggcccaccgcttcctgctcaggaggacgttcatcccagacccccaaggcacc
aacctcatgtttgccttttttgcacaacacttcacccatcagttcttcaaaacctctggc
aagatgggtcctggcttcaccaaagccttgggccatggggtggacctcggccacatttac
ggagacagcctagaacggcagtatcacctgcgtctctttaaggatgggaaactcaagtac
caggtgctggatggagaggtgtacccgccgtcggtggaagaagcacccgtcctgatgcac
tacccgcggggcgtgccgccccggagccagatggccgtgggccaggaggtgtttgggctg
ctgcccgggctcatgctctatgccacgctctggctacgtgaacacaaccgcgtgtgtgac
ctgctaaaggccgagcacccgacctgggacgatgagcagctcttccagactacccgcctc
atcctcataggggagaccatcaagatcgtcatcgaggagtacgtgcagcagctgagcggc
tacttcctgcagctcaagtttgaccccgagatgctgttcagcgtccagttccagtaccgc
aaccgcatcgccatggagttcaaccacctctaccactggcatccgctcatgcccgactcc
ttccaggtgggctcgcaggagtacagctacgagcagttcttgttcaacacctccatgctg
gtggactacggggtcgaggcgctagtggacgccttctctcgccagagcgctggccggatc
ggtggtggcaggaacattgaccaccacgtcctgcacgtggccgtggaggtcatcaaggag
tctcgagagatgcggctgcagcccttcaacgagtaccgcaagcggttcggcttgaagccc
tacgcctctttccaggagctcactggagagacagagatggcagcggagttggaagagctc
tatggagacattgacgccttggaattctacccggggctgcttctggaaaagtgccagcca
aactccatctttggggagagcatgatcgagattggggctcccttctccctcaagggtctt
ttagggaaccccatctgttccccagagtactggaagccaagcacatttggtggcgaggtg
ggctccaatctcatcaagacagccacactgaagaagctggtttgcctcaacaccaagacc
tgcccctacgtttccttccgtgtgccccgctccagtggggacgatgggcctgctgcagag
cggcgatccacagagctctga

DBGET integrated database retrieval system