KEGG   Oryctolagus cuniculus (rabbit): 100342335Help
Entry
100342335         CDS       T03373                                 

Gene name
PHF11
Definition
(RefSeq) histone-lysine N-methyltransferase SETDB2
  KO
K18494  
histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ocu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100342335 (PHF11)
Enzymes [BR:ocu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100342335 (PHF11)
Chromosome [BR:ocu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100342335 (PHF11)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100342335 (PHF11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
Un
AA seq 702 aa AA seqDB search
MGEKNGDAKTFWMELEDHGKVDFIFEQVQNVLQSLKQKIKDGSATNKEYIQAMILVNEAT
LNNNFSLVKGHIPVTENEKGNKSQSFPSTSCENLFPEDSTFPSTGNKEILPLENKVVGLR
ARKSSLHLSYQSHDCSRACLVKMPSFKGENPLQLPIKCHFQRRHAKTNSHSSALHVSYKT
PCGRSLRNVEEVFRYLLETECNFLFTDNFSFNTYVQLTRNYPKQEEIVSDVDISNGVESV
PISFCNEIDSRKLPQFKYRKTMWPRTYYLNSFSNMFTDACDCSEGCIDITKCACLQLTAR
NAAVCPLSSNKIMTGYKYKRLQRQIPTGIYECSLLCKCNRQMCQNRVVQHGPQVRLQVFK
TEKKGWGVRCLDDIDRGTFVCTYSGRLLSRANFEKPGNENEKEENIVKSIFSKKRKIEVA
CSECEVEVIPLELETHPRSAESEDCSPKFSNNSKESIMETKCNNISGTPYHSVTKSPKSK
TAVFQHNEKKMGFVSSESVSLEGSDGFKPNQEYLNSRVGRVQKESSSKQVEDSEENPLIE
SDVIDITKCSEETPPRDGCNQTTTLINQNTKNEVQIQKPQMKKSTTYQNQQLFCVDELPS
ETKSTSSDSPTKFSKENMFLLDATKEGNVGRFLNHSCCPNLLVQNVFVETHDRNFPLVAF
FTNRYVKARTELTWDYGYEAGTVPEKEIICHCGVNKCRKKIL
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaaaaaatggtgatgcaaaaactttctggatggagctggaagatcatggaaaa
gtagactttatttttgaacaagtgcagaatgtgctgcagtcactgaaacagaagatcaaa
gatggctctgccacaaataaagaatatatccaagcaatgatcctagtgaatgaagcaact
ctaaataacaatttttcattggtaaagggtcatatacctgtgactgagaatgaaaaggga
aacaaatcacaatcatttccctctacatcctgtgaaaacttgtttcctgaagacagtaca
tttccatctacaggaaacaaagagattcttcctctggaaaataaagttgtaggcttgaga
gcaagaaaatcatctttgcatttatcttaccaaagtcatgattgctctcgtgcctgtctg
gtgaaaatgccaagcttcaaaggagaaaaccctctacagcttccaatcaagtgtcacttc
caaaggcgacacgcgaagacaaactctcattcgtcagcactccatgtgagttataaaact
ccttgtggaaggagtctacgaaacgtggaggaagtttttcgttacctgcttgagacagag
tgtaactttttatttacagataacttttctttcaatacctatgttcagttgactcggaat
tacccaaagcaagaagaaattgtttctgatgtggatattagcaatggagtggagtcagtg
cccatttctttctgtaacgaaattgacagtagaaagcttccacagtttaagtacagaaag
actatgtggccacgaacttattatctaaacagcttttccaacatgtttactgatgcatgt
gactgttctgagggctgcatagacataacaaaatgtgcatgtcttcaactgacagcaaga
aatgccgcagtttgtcctttgtcaagtaataaaataatgactggatataaatataaaaga
ctacagagacaaatacctactggtatttatgaatgcagcctgttgtgcaagtgtaatcga
caaatgtgtcaaaatcgagttgtccaacatggtcctcaagtgagactacaggttttcaaa
actgagaagaaaggctggggggtacgctgcctagatgacattgacagagggacatttgtt
tgcacttactcaggtagattactaagcagagctaactttgagaaacctggtaatgaaaat
gaaaaagaagagaatattgtgaaaagtatattttcaaaaaagaggaaaatagaagttgcc
tgttcagagtgtgaggttgaagttattccattagaattggaaacacatcctagaagtgct
gaaagtgaggactgttcacctaaattcagtaataattccaaagagtctattatggaaaca
aagtgcaacaacatctcaggaactccgtatcattcagttactaaaagtcctaaatccaag
acagctgtttttcaacacaatgagaaaaagatgggatttgtttcctcggaatctgtctcc
ttggagggtagtgatggatttaaaccaaaccaagaatatctgaactccagagtcggcaga
gtgcaaaaagagtcaagttcaaaacaagttgaagattctgaagagaatcctctgattgaa
tcagatgtgatagatataactaaatgttcagaagagactccaccaagggacggatgtaac
caaacaactacattgattaatcaaaatactaaaaatgaggttcaaatacagaagccccaa
atgaaaaaatctacaacatatcaaaatcagcagctcttttgtgttgatgagttgccaagt
gaaaccaagagcacttcatctgattctccaacaaagttcagtaaagagaatatgttttta
ttggatgccacaaaagaaggaaatgtgggccgcttccttaaccatagttgttgcccaaat
ctcttggtacagaatgtttttgtagaaacacacgacaggaattttccattggtggcattc
ttcaccaacaggtatgtgaaagcaagaacagaactaacctgggattatggttatgaagct
ggaactgtacctgagaaggaaatcatctgccattgtggggttaacaagtgtagaaaaaaa
atactatga

DBGET integrated database retrieval system