KEGG   Oryctolagus cuniculus (rabbit): 100354541Help
Entry
100354541         CDS       T03373                                 

Gene name
ASH1L
Definition
(RefSeq) ASH1 like histone lysine methyltransferase
  KO
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ocu00001]
  Amino acid metabolism
   00310 Lysine degradation
    100354541 (ASH1L)
Enzymes [BR:ocu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100354541 (ASH1L)
Chromosome [BR:ocu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100354541 (ASH1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
13
AA seq 2961 aa AA seqDB search
MDPRNTAMLGLGSDSEGFLRKSPSAIHTGTLVSKKEVELENNTKEEEDLRKRNRERSVEA
GKEDGLTDEQQQFSVKETNFSEGNLKLKIGLQAKRTKKPPKNLENYVCRPAIKTTIRHPR
KTLKSGKMTDEKNEHCPSKRDPSKLYKKAGDVAAIECQSEESIHLHSQGESTPLSKKLSP
VHSEMADFVNASPSTLVGSRDPDLKDRALLNGGTSVTEKLAQLIATCPPSKSSKTKPKKL
GTGTTAGLVSKDLIRKAGIGSVAGIIHKDLIKKPTISTAVGLVTKDAGKKPMFNPAVGLV
NKDSVKKLGTGTTAVFINKDLGKKPGTITTVGLLSKDSGKKLGIGIVPGLMNKESGKKLG
LGTVVGLVNKDLGRKLSSTVGLVAKDCAKKIVASSAMGLVNKDIGKKLVTCPVAGLVSKD
AINLKAEALLPTQDPLKASCSANISNHESEELSESLKDSATSRTFEKNVIRQNKESALEK
FSARKEIINLEKEIFNEGSCIQQDSFSSSERGSYETSKHEKQPPVYCTSPDFQMGGGSDA
STAKSPFSAVGESNLPSPSPTVSVNPLTRSPPETSSPLAPNPLLLSPTTELMEEISESVG
KNQFNSESTHLNVGHRSMGHSISIECKGIDKELNDSKTTHIDIPRISSSLGKKPNFTSES
SIHTITPSVVNFTSLFSNKPFLKLGAVSAPDKHCQVAESLSTSLQSKPLKKRKGRKPRWT
KVVARSTCRSPKGLELERSELFKNVSCGSLSNSSSESAKFMKNIGSTSFVDHDFLKRRLP
KLSKSTSPSLALLTDGEKPSHKSFATHKLSSSMCVSSDLLSDIYKPKRGRPKSKEMPQLE
GPPKRTLKIPASKVFSLQSKEEQEPPILQPEIEIPSFKQSLSVSPFPKKRGRPKRQMRSP
VKMKPPVLSVAPFVATESPSKLESESENHRSSSDFFESEDQLQDPDDLDDSHRPSVCSMS
DLEMEPDKKITKRNNGQLMKTIIRKINKMKTLKRKKLLNQILSSSVESSNKGKVQSKLHN
TVSSLAATFGSKLGQQINVSKKGTIYIGKRRGRKPKTVLNGILSGSPTSLAVLEQTAQQA
AGSALGQILPPLLPSSASSSEILPSPICSQSSGTSGGQSPVSSDAGFVEPSSVPYLHLHS
RQGMIQTLAMKKASKGRRRLSPPTLLPNSPSHLSELTSLKEATPSPISESHSDETIPSDS
GIGTDNNSTSDRAEKFCGQKKRRHSFEHVSLIPPESSTVLSGLKEKHKHKCKRRNHDYLS
YDKMKRQKRKRKKKYPQLRNRQDPDFIAELEELISRLSEIRITHRSHHFIPRDLLPTIFR
INFNSFYTHPSFPLDPLHYIRKPDLKKKRGRPPKMREAMAEMPFMHSLSFPLSSTGFYPS
YGMPYSPSPLTAAPIGLGYYGRYPPTLYPPPPSPSFTTPLPPPSYMHAGHLLLNPTKYHK
KKHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMAYGWMVEHKHRHRHKHREHRSEQPQVSM
DAGSSRSVLESLKRYRFGKDTLGERYKHKEKHRCHMSCPHLSPSKSLINREEQWVHREPS
ESSSLALGLQTPLQIDCSESSPGLSLGGFTPNSEPASSDEHTNLFTSAIGSCRVSNPNSS
GRKKLTDSPGLFAQDTTLNRPHRKEPLPSSERAVHTLTGSQSTSDKPSQRSSESTNCSPA
RKRSSSESTSSTVNGVPSRSPRLVASGDDSVDSLLQRMVQNEDQEPMEKNIDAVIATASA
APSSSPGRSHSKERTLGKPDSLLVPAVPIDPCSNSISLLSEKLTSSCSPHHIKRSVMEAM
QRQARKMCNYDKILATKKNLDHVNKILKAKKLQRQARTGNNFVKRRPGRPRKCPLQAVVS
MQAFQAAQFVNPELNEGEEAAALHLNPDTVTDVIEAVVQSVNLNPEHKKGLKRKSWFLNE
QARKKQKSLPEEEEQENNKSFTEAPVEIPSPSDTPAKPPEPESNLQPVLSLIPREKKAPR
PPKKKYQKAGLYSDVYKTTDPKSRLIQLKKEKLEYTPGEHEYGLFPAPIHVGKYLRQKRI
DFQLPYDILWQWKHNQLYKKPDVPLYKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKG
CVDDCLNRMIFAECSPNTCPCGDQCCNQRIQRHEWVQCLERFRAEEKGWGIRTKEPLKAG
QFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARFINHSCDPN
CEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVEKQQLCKCGFEKCRGIIGGKS
QRMNGLASGKSNQPITTHKKSGRSKEKRKSKHKLKKRKGHFSEETNENINTPTRLTPQLQ
MKPMSNRERNFVLKHHVFLVRNWEKIRQKQEEVKHTSDNIHSASLYTRWNGICRDDGNIK
SDVFMTQFSALQTARSVRTRRLAAAEENIEVARAARLAQIFKEICDGIISYKDSSRQALA
APLLNLPPKKKNADYYEKISDPLDLITIEKQILTGYYKTVEAFDADMLKVFRNAEKYYGR
KSPIGRDVCRLRKAYYNARHEASAQIDEIVGETASEADSSETSVSEKENGHEKDDDVIRC
ICGLYKDEGLMIQCDKCMVWQHCDCMGVNSDVEHYLCEQCDPRPVDREVPMIPRPHYAQP
GCVYFICLLRDDLLLRQGDCVYLMRDSRRTPDGHPVRQSYRLLSHINRDKLDIFRIEKLW
KNEKDERFAFGHHYFRPHETHHSPSRRFYHNELFRVPLYEIIPLEAVVGTCCVLDLYTYC
KGRPKGVKEQDVYICDYRLDKSAHLFYKIHRNRYPVCTKPYAFDHFPKKLTPKRDFSPHY
VPDNYKRNGGRSSWKSERSKPPLKDLGQEDDALPLIEEVLASQEQAANEMHSMEEPEQEG
ATAQVSEGEKNTEESSQEPQPACTPEERRHNQRERLNQILLNLLEKIPGKNAIDVTYLLE
EGSGRKLRRRTLFIPENSFRK
NT seq 8886 nt NT seq  +upstreamnt  +downstreamnt
atggaccctagaaatactgctatgttaggattgggttctgattccgaaggttttttgcga
aagagtccttctgccatccatactggcacgctggtcagtaagaaagaagtggagctagag
aataacacaaaggaggaagaggaccttcgcaaacggaatcgggaaagaagcgttgaagca
gggaaagaggatggtttgactgatgaacagcagcagttttcagtgaaagaaacaaacttt
tcagagggtaatttaaaactgaaaattggccttcaggctaagagaactaaaaaacctcca
aagaacttggagaattatgtgtgtcgacctgccataaaaacaactatcaggcatccaagg
aaaacactgaaaagtggaaagatgacagatgaaaagaatgaacactgtccttcgaaacgg
gacccttccaagttgtacaagaaagcaggtgatgttgcagccattgaatgccaatctgaa
gaaagcatccatcttcattcacagggagaaagcactcctttgtccaagaagctttctcca
gtacactcagaaatggcagattttgttaatgcatcaccatctactcttgttggtagtcgg
gatcctgatttaaaggacagagcattacttaatggaggaactagcgtaacagaaaagttg
gcacagctcattgctacttgtcctccctccaagtcttccaagacaaaaccgaagaagtta
ggaacaggcactacagcaggattggttagcaaggatttgatcaggaaagcaggcattggc
tctgtggctggaataatacataaggatttaataaaaaaaccaactattagcacagcagtt
ggattggtaactaaagatgctgggaaaaagccaatgtttaacccagcagtaggactggtc
aataaagactctgtgaaaaaactgggaactggcactacagccgtattcattaataaagac
ttgggcaaaaagccagggactatcactacagttggactgctgagcaaggattcaggaaag
aagctaggaattggtattgttccgggtttaatgaataaggagtctggcaagaagttagga
cttggcactgtggttggactggttaataaagacttgggaaggaaattgagttctactgtt
ggcctagtggccaaggactgtgcaaagaagattgtagcaagttcagcaatgggattggtt
aataaagacattggaaagaaactagtgacctgtcctgtggcaggactggtcagtaaagat
gccataaaccttaaagcggaagcactgctccctactcaggatccacttaaggcttcttgt
agtgcaaacatcagtaaccacgaaagtgaagaactttctgaatccctgaaagacagtgcc
accagcagaacttttgagaagaatgtcattcggcagaacaaagaaagtgcactagaaaag
ttctcagctcgaaaagaaatcattaatttggagaaagaaatatttaatgaaggatcatgc
attcagcaagacagtttctcatccagtgaaaggggatcttatgaaacctcaaagcatgaa
aagcaacctcctgtatattgcacttctccagactttcagatgggaggtggttctgatgca
tctacagctaaatccccttttagtgcagtaggagaaagcaatctcccttccccatcacct
actgtatctgttaatcctttaactagaagtccacctgaaacttcttcaccgttggctcct
aatccgttacttcttagtcctaccacagaactaatggaagaaatttctgagtctgttgga
aagaatcagtttaattctgaaagtacccatttgaatgttggtcataggtccatgggtcat
agcataagtattgagtgtaaagggattgataaagaactaaatgattcaaaaactacccat
atagatattccaagaataagctcttccctgggaaaaaagccaaatttcacttctgaatcc
agtattcatacaattactccctcagttgttaacttcactagtttatttagtaacaaacct
tttctaaaacttggtgcggtaagtgcaccagacaaacactgccaagttgctgaaagtcta
agcactagtttgcagtccaaaccattaaaaaaaagaaaaggaagaaagcctcggtggact
aaagtggtagcaagaagcacatgccggtctccaaaagggctagaattagaaaggtcagag
ctttttaaaaatgtttcctgtggctcactatcaaatagtagttccgagtcagccaagttt
atgaaaaacattggatcaacttcgtttgtagatcatgacttccttaaacgccgattgcca
aagttgagcaaatccacatctccatctcttgctctcttaactgatggtgaaaaaccgtct
cataagtcttttgctactcataaactatcctctagtatgtgtgtctctagtgaccttttg
tcggatatttacaagcccaaaagaggaagacctaaatcaaaagagatgcctcaactagaa
ggtccacctaaaaggactttaaaaatccctgcctctaaagtattttctctgcagtctaaa
gaagaacaagaacccccaattttacagccagaaattgaaattccttccttcaaacaaagt
ttgtctgtgtctccttttccaaaaaagagaggcaggcctaagaggcaaatgagatcacca
gtcaagatgaagccacctgtgctatcagtagctccatttgttgccactgaaagtccaagc
aagctagagtcagaaagtgaaaaccatagaagcagcagtgatttctttgagagtgaggat
cagcttcaggatccagacgatttagatgacagtcacaggccaagtgtttgtagtatgagt
gaccttgaaatggaaccagataaaaaaattacgaagagaaacaatggacaattaatgaaa
acaattatacgcaaaataaataaaatgaagactttaaagagaaagaaactgttgaatcag
attctttcaagctctgtagaatcaagtaataaagggaaagtgcaatccaagctccataat
acagtatcaagtcttgctgccacatttggttctaaattgggccaacagataaacgtcagc
aagaaaggaaccatttacataggaaagaggaggggtcgcaagccaaaaactgtcttaaat
ggcattctttctggtagccctaccagccttgctgtccttgagcaaacagcgcagcaggca
gctgggtcagcgttaggacagattctcccccctttgctgccttcatctgctagtagttct
gagattcttccgtcacctatttgttctcagtcttctgggactagtggaggtcagagccct
gtaagtagtgatgcaggctttgttgaacccagttcagtgccatatttgcatttgcactcc
agacagggcatgattcagactcttgcaatgaagaaggcctcaaaggggaggaggcggtta
tctcctcctactttgttgccaaattctccttcccacttgagtgaactcacatctctgaaa
gaagctactccttccccaattagtgagtctcatagtgatgagaccatccccagtgatagt
ggaattggaacagataataacagcacatcagatagagcagagaaattttgtggacaaaaa
aagagaaggcattcttttgagcatgtttctctgattccccctgaatcttctacagtctta
agtggtcttaaagaaaagcataaacacaaatgtaagcgcaggaatcatgattatctcagc
tacgacaagatgaaaaggcagaaacgaaaacggaaaaagaaatatccccaactccgaaac
agacaggatccagactttattgcagagctggaggaactaataagtcgtctaagtgaaatt
cggatcacccatcgaagtcatcattttatcccccgggaccttctgccaactatttttcga
atcaactttaatagtttctatacacatccttcttttcccttagatcctttgcactacatt
cgaaaacctgacttaaaaaagaaaagggggaggccccctaagatgagggaggcaatggct
gaaatgccttttatgcacagccttagttttcctctttctagtactggtttctatccatca
tatggcatgccttattctccttcacctcttacagctgctcctataggattaggttactat
gggaggtatcctcccactctttatcctccacctccatctccttctttcaccactccactt
ccacctccttcctacatgcatgctggtcatttacttctcaatcccaccaaataccacaag
aaaaaacataagctacttcgacaggaggcctttcttacaaccagtaggactcctctcctt
tccatgagtacctatcccagtgtccctccggagatggcctacggttggatggttgagcac
aaacacaggcaccgtcacaaacacagagaacaccgttctgaacagccccaggtttccatg
gacgctggctcttccagatctgtcctggagtcattgaagcgctatcgctttggaaaggat
actcttggagagcgatataagcataaagaaaagcaccgttgtcacatgtcctgccctcat
ctctctccttcaaaaagcttaataaacagagaagagcagtgggtccaccgagagccttca
gaatctagttcattggccttgggattgcagacacctttacagattgactgttcagaaagt
tctccaggtttatcccttggaggatttactccaaactctgagccagccagcagtgatgaa
cacacaaaccttttcacaagtgcaataggcagctgcagagtttcaaaccctaactccagt
ggccggaagaaattaactgacagccctggactctttgcacaggacactacactaaatcgg
cctcacagaaaggagccactgccttccagtgaaagggcagtacacactttaacaggttcc
cagtcaacttcagataaaccctcccagcgatcatcagaaagcacaaactgtagccctgcc
cgaaagaggtcttcatctgagagtacttcttcaacagtaaatggagttccctctcgaagc
ccaagattggttgcttctggagatgactctgtggatagcctgctgcagcggatggtacaa
aatgaagaccaagagcccatggagaaaaacattgatgctgtgattgcaactgcctctgca
gctccttcctccagtccaggacgtagccacagcaaggagcggacgctaggaaaaccagac
agccttctagtgcctgcagtccccattgacccttgcagtaatagcatctcactcctttct
gaaaaattgacaagcagctgttcccctcatcatatcaaaagaagtgtaatggaagctatg
cagcgccaagctcggaaaatgtgcaattatgacaaaattttggccactaagaaaaactta
gaccacgtcaataaaattttaaaagccaaaaaacttcaaaggcaggccaggacaggaaat
aacttcgtaaaacgcagaccaggtcgacctcggaaatgtcctctccaggccgtagtatca
atgcaggcattccaggctgcccagtttgtcaacccagaattgaatgaaggtgaagaggca
gcagcactgcacctcaatcctgatacagttacagatgtaattgaagctgttgttcagagt
gtaaacctgaacccagaacataagaagggtttgaaaaggaaaagctggttcttgaatgaa
caggccaggaaaaagcagaagtcattacccgaggaagaagaacaagagaataataaaagc
tttactgaagcaccagttgagattcccagtccttctgacaccccagccaaacctcccgaa
cctgaaagtaacttgcagcctgtgctctctctcatcccaagggaaaagaaggccccacgt
cccccaaagaagaagtatcagaaagcagggctgtattctgatgtttacaaaactacagat
ccaaagagccgattgatccagttaaagaaagagaagctggagtatactccaggagagcat
gaatatggattattcccagcccccattcatgttggaaagtatctaagacaaaagagaatt
gacttccagcttccctatgacatcctctggcagtggaaacacaatcagctatacaaaaag
ccagatgtcccactatataaaaaaattcgttcaaatgtctacgttgatgtcaaacccctt
tctggttacgaggctaccacctgtaactgtaagaagccagatgatgacaccaggaagggc
tgtgtggatgactgcctcaatagaatgatctttgctgagtgttcccccaacacttgcccc
tgtggtgatcagtgctgtaaccagaggatacaaaggcatgagtgggtgcaatgtctagaa
cgatttcgagctgaagaaaaaggctggggaatccgaaccaaagaacccttaaaagctgga
caattcatcattgaatatctaggggaggttgtcagcgaacaggagttcagaaacaggatg
attgagcaataccataatcacagtgaccactactgtctgaacttggatagcggtatggtg
attgacagttaccgcatgggaaatgaggcccgattcatcaatcacagctgcgacccaaat
tgtgaaatgcagaaatggtctgttaatggagtataccggattggactgtatgctcttaaa
gacatgccagctggtactgaactcacttatgattacaacttccattccttcaatgttgaa
aaacagcaactttgtaaatgtggctttgagaaatgtcgcggaatcatcggaggcaagagt
caacgcatgaatggactcgccagcggcaaaagtaaccagcctataaccacacataaaaag
tctggacggtcgaaagagaagagaaagtctaagcacaagctgaagaaaaggaaaggtcat
ttctctgaggaaaccaatgaaaacatcaacactccaacaagattgaccccccaattacag
atgaagccaatgtccaatcgagagaggaactttgtattgaagcatcatgtgttcttggtc
cgaaactgggagaaaattcgtcagaaacaggaggaagtaaagcacaccagtgataatatt
cactctgcatcattatatacccgctggaatggcatctgtcgagatgatgggaatatcaag
tctgatgttttcatgacccagttctctgccctgcagacagctcggtctgttcgaacaaga
cggttggcagctgcagaagaaaacattgaagtggctcgggcagcccgcctggcccagatc
ttcaaagagatctgtgatggtatcatctcttataaagattcttcccgacaagccctggca
gctccacttttgaacctccccccaaagaaaaagaatgctgattattatgagaagatctct
gatcctctagatctcatcaccatagaaaagcagatccttactggctattataaaacagta
gaagcgtttgatgctgacatgctcaaggtctttcggaatgctgagaagtactacgggcgt
aaatccccaattgggagagacgtttgccgcctacgaaaggcctattacaatgcccggcac
gaggcatcagcccaaattgatgagattgtgggagagacagcaagtgaagcagacagcagt
gaaacctcagtctcggagaaggagaatgggcatgagaaggacgatgacgtgatccgctgt
atctgtggcctctacaaggatgagggcctcatgatccagtgtgacaagtgcatggtgtgg
cagcactgtgactgtatgggagtgaactcagatgtggaacattacctttgtgagcagtgt
gacccaaggccagtggacagggaggtgcccatgatccctcggccccactatgctcaacca
ggctgtgtctacttcatatgtttgctccgagatgacttgctgcttcgccaaggtgactgt
gtgtatctgatgagggatagtcggcgcaccccagatggccacccagttcgtcagtcctat
aggctgttatctcacattaaccgagataaacttgacatcttccgcattgagaagctttgg
aagaatgagaaagatgagcgatttgcctttggtcaccattatttccgtccccatgaaacc
caccattctccatcccgtcggttctaccacaatgaactgtttcgtgtgccactttatgag
atcattcccttggaggccgttgtggggacctgctgtgtgttggacctttatacatattgt
aaagggagacccaaaggagtgaaggagcaagatgtctacatctgtgattatcggcttgac
aagtcagcacaccttttctacaagatccaccggaaccgctatcctgtctgcaccaaaccg
tatgcctttgatcacttccccaagaagcttactcccaaaagagatttctcacctcattat
gtcccggacaactacaagaggaacggaggtcggtcatcctggaagtctgagcgctcaaag
ccaccgttaaaagacctgggccaggaggatgatgctctgcccttgattgaagaggttcta
gccagtcaggagcaagcggccaatgagatgcacagcatggaggaaccagaacaggaggga
gcaacagcccaagttagtgagggtgaaaaaaacacagaggaaagtagtcaagagccccag
ccagcctgtacccctgaggagcgacggcataaccagcgggagcggctcaaccagatcctg
cttaatctgcttgaaaaaatccctgggaaaaatgccattgatgtgacctacttgctggag
gaaggatcgggcagaaagctgcgaaggcgtactttgtttattccagaaaacagctttcgg
aagtga

DBGET integrated database retrieval system