KEGG   Oryctolagus cuniculus (rabbit): 100355860Help
Entry
100355860         CDS       T03373                                 

Gene name
HDAC7
Definition
(RefSeq) histone deacetylase 7
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04371  Apelin signaling pathway
ocu05034  Alcoholism
ocu05165  Human papillomavirus infection
ocu05169  Epstein-Barr virus infection
ocu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    100355860 (HDAC7)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100355860 (HDAC7)
  Substance dependence
   05034 Alcoholism
    100355860 (HDAC7)
  Infectious diseases
   05169 Epstein-Barr virus infection
    100355860 (HDAC7)
   05165 Human papillomavirus infection
    100355860 (HDAC7)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100355860 (HDAC7)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100355860 (HDAC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 100355860
NCBI-ProteinID: XP_017198741
LinkDB All DBs
Position
8
AA seq 1014 aa AA seqDB search
MPKKFQGENTKSAAARARRAEAKAAADAKRQQELEQQRQREQQRQEELEKQRLEQQLLIL
RNKEKSKESAIASTEVKLRLQEFLLSKSKEPTPGGLNHSLPQHPKCWGAHHASLDQSSPP
QSGPPGTPPSYKLPLLGPYDNRDDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDG
TVISTFKKRAVEITGAGPGVPSVCNSAPGSGPSSPNSSHSTIAENGFTGSVPNIPTEMLP
QHRALPLDSSPNQFSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSL
RQGGTLTGKFMSTSSIPGCLLGVALEGDASPHGHASLLQHVLLLEQARQQSALIAVPLHG
QSPLVTGERVATSMRTVGKLPRHRPLSRTQSSPLPQSPQALQQLVMQQQHQQFLEKQKQQ
QLQLGKMLTKTGELPRQPTTHPEETEEELTEQQEVLLGEGALPMPREGSTESESTQEDLE
EEEEDEEEDDEDCIQVKDEEGESGPEEGPDSEESSAGYKKLFPDAQQLQPLQVYQAPLSL
AAVPHQALGRTQSSPAAPGSVKSPPDQPTKHLFTTGVVYDTFMLKHQCMCGNTHVHPEHA
GRIQSIWSRLQETGLLSKCERIRGRKATLDEIQTVHSEYHTLLYGTSPLNRQKLDSKKLL
GPISQKMYAMLPCGGIGVDSDTVWNEMHSSSAVRMAVGCLVELAFKVAAGELKNGFAIIR
PPGHHAEESTAMGFCFFNSVAITAKLLQQKLNVGKVLIVDWDVHHGNGTQQTFYQDPSVL
YISLHRHDGGNFFPGSGAVDEVGAGSGEGFNVNVAWAGGLDPPMGDPEYLAAFRTVVMPV
AREFSPDLVLVSAGFDAAEGHPAPLGGYRVSAKCFGCMTQQLMSLAGGAVVLALEGGHDL
TAICDASEACVAALLGNKVDPLAEEGWTQKPNLNAIRSLEAVIRVHSKYWGCMQRLAACP
GSWVPRGPGTDAEVEAVTALASLSVGILAEDSLASPPLHRPTEQLTEEEEPMNL
NT seq 3045 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagaagttccagggcgagaacaccaagtcggcggcggcccgggcgcgcagggcg
gaggccaaggcggcggcggacgccaagaggcagcaggagctggagcagcagcggcagcgg
gagcagcagcggcaggaggagctggagaagcagaggctggagcagcagctgctcatcctg
cgcaacaaggagaagagcaaagagagcgccatcgccagcacggaggtgaagctcaggctc
caggagttcctcctgtccaagtcaaaggagcccacgccaggcggcctcaaccattccctc
ccacagcaccccaaatgctggggagcccaccatgcttctttggaccagagttcccctccc
cagagcggcccccctgggacgcctccctcctacaaactgcctttgcttgggccctacgac
aaccgagatgacttcccgctccgcaagacagcctctgaacccaacttgaaagtgcgttcg
aggctaaaacagaaggtggcggagcggagaagcagtcccctcctgcgtcgcaaggacggg
accgtcatcagcacctttaagaagagagcagttgagatcacgggcgccgggcctggagtg
ccgtccgtgtgtaacagtgcgcctggttccggccccagctcccccaacagctcccacagc
accatcgccgagaacggcttcactggctcagttcccaacatccccaccgagatgctcccc
cagcaccgggccctccctctggacagctcccccaaccagttcagcctctacacgtctccc
tctctgcccaacatctccctagggctgcaggccacggtcactgtcaccaactcacacctc
actgcctccccgaagctgtcgacgcagcaggaggccgagaggcaggccctccagtccctg
cggcagggcggcacgctgacgggcaagttcatgagcacatcctccatcccgggctgcctg
ctgggcgtggcgctggagggcgacgccagcccccacggacacgcctccctgctacagcac
gtgctgctgctggaacaggcccggcagcagagcgccctcatcgcggtgccgctgcatggg
cagtccccgctggtgacaggggaacgcgtggccaccagcatgcggacggtgggcaagctc
ccgcggcaccggcccctgagccgcacccagtcctccccgctgccgcagagcccccaggcc
ctgcagcagctggtcatgcagcagcagcaccagcagttcctggagaagcagaagcagcag
cagctgcagctgggcaagatgctcaccaagaccggggagctgccgaggcagcccaccaca
caccctgaggagaccgaggaggagctgacggagcagcaggaggtcctgctgggggagggc
gccctgcccatgccccgggaaggctccacggagagtgagagcacccaggaagacctggag
gaggaggaggaggacgaggaagaggacgatgaggactgcatccaggtcaaggacgaggag
ggcgagagcggcccggaggaggggcccgactcggaggagtccagtgctggctacaaaaag
ctgttcccagatgcccagcagctgcagcccctgcaagtgtaccaggcgcccctcagcctg
gccgctgtgcctcaccaggccctgggccgcacccagtcctcacctgctgcccccgggagc
gtgaagagccccccagaccagcccaccaagcacctcttcaccacaggtgtggtttacgac
acgttcatgctgaagcaccagtgcatgtgtgggaacacgcacgtgcaccccgagcacgct
ggccgcatccagagcatctggtcccggctgcaggagacgggcctgctcagcaaatgtgag
cggattcggggtcgcaaagctacgctggacgagatccagacggtgcactctgagtaccac
accctgctctatgggaccagccccctcaaccggcagaagctggacagcaagaaactgctt
ggccccatcagccagaagatgtacgccatgctgccttgtgggggcatcggagtggacagt
gacaccgtgtggaacgagatgcactcgtccagtgctgtgcgcatggcagtgggctgcctc
gtggagctggccttcaaggtggccgcgggggagctcaagaatggatttgccatcatccgg
cccccaggacaccacgccgaggaatccacagccatgggattctgcttcttcaactctgta
gccatcacagccaaactcctgcagcagaagctgaacgtgggcaaggtcctcatcgtggac
tgggacgtgcaccacggcaatggcacgcagcagaccttctaccaggaccccagcgtgctc
tacatctctctgcaccgccacgacggcggcaacttcttcccgggcagcggggccgtggac
gaggtgggcgctggcagcggagagggcttcaacgtgaacgtggcctgggctggaggcctg
gacccccctatgggggaccccgagtacctggctgccttcaggacggtcgtgatgcccgtc
gcccgggagttctctccagacctggtgctggtgtcggcagggtttgatgcggccgagggc
caccctgcccccctgggtggctaccgagtctctgccaaatgtttcgggtgcatgacgcag
cagctgatgagcctggcaggaggcgccgtggtgctggccctggagggtggccatgacctc
acagccatctgtgacgcctcggaggcctgcgtggccgccctgctgggcaacaaggtggac
ccgcttgcagaagagggctggacgcagaagcccaacctcaacgccatccgctccctggag
gctgtgatccgtgtgcacagcaagtactggggctgcatgcagcgcctggccgcctgccct
ggctcctgggtgcccaggggcccggggaccgacgcagaagtggaggctgtgacagcactg
gcatccctctctgtgggcatcctggccgaagacagcctcgcctcccctcccctgcacagg
cctactgagcagctgacggaagaggaagaacccatgaacctctga

DBGET integrated database retrieval system