KEGG   Oryctolagus cuniculus (rabbit): 108176185Help
Entry
108176185         CDS       T03373                                 

Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
  KO
K04347  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04062  Chemokine signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04371  Apelin signaling pathway
ocu04713  Circadian entrainment
ocu04723  Retrograde endocannabinoid signaling
ocu04724  Glutamatergic synapse
ocu04725  Cholinergic synapse
ocu04726  Serotonergic synapse
ocu04727  GABAergic synapse
ocu04728  Dopaminergic synapse
ocu04810  Regulation of actin cytoskeleton
ocu04926  Relaxin signaling pathway
ocu05032  Morphine addiction
ocu05034  Alcoholism
ocu05167  Kaposi's sarcoma-associated herpesvirus infection
ocu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    108176185
   04010 MAPK signaling pathway
    108176185
   04371 Apelin signaling pathway
    108176185
   04151 PI3K-Akt signaling pathway
    108176185
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    108176185
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    108176185
  Endocrine system
   04926 Relaxin signaling pathway
    108176185
  Nervous system
   04724 Glutamatergic synapse
    108176185
   04727 GABAergic synapse
    108176185
   04725 Cholinergic synapse
    108176185
   04728 Dopaminergic synapse
    108176185
   04726 Serotonergic synapse
    108176185
   04723 Retrograde endocannabinoid signaling
    108176185
  Environmental adaptation
   04713 Circadian entrainment
    108176185
 Human Diseases
  Cancers
   05200 Pathways in cancer
    108176185
  Substance dependence
   05032 Morphine addiction
    108176185
   05034 Alcoholism
    108176185
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    108176185
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108176185
  Exosomal proteins of colorectal cancer cells
   108176185
GTP-binding proteins [BR:ocu04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    108176185
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma
Motif
Other DBs
NCBI-GeneID: 108176185
NCBI-ProteinID: XP_017195731
Ensembl: ENSOCUG00000024063
UniProt: G1TJ50
LinkDB All DBs
Position
Un
AA seq 72 aa AA seqDB search
MSGKVAIGSDIGQARRAVEQLRMEAGIDRVKVSKAAADLLQFCTEQAKSDLFLVGIPAAT
NPFKEKKPCAIL
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcaaggtagccatcggcagcgacatcgggcaagcccgccgggcagtggagcag
ctacggatggaggccggcattgaccgtgtgaaggtgtccaaggcggccgctgacctactg
cagttctgcacggagcaggccaagagcgacctcttccttgtgggcatcccggccgccacc
aaccccttcaaggagaagaagccctgtgccatcctgtga

DBGET integrated database retrieval system