KEGG   Olea europaea var. sylvestris (wild olive): 111390908Help
Entry
111390908         CDS       T05244                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain clone 512-like
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Brite
KEGG Orthology (KO) [BR:oeu00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    111390908
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    111390908
Enzymes [BR:oeu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     111390908
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 169 aa AA seqDB search
MSATGFSAVVAGSTYAGLTSNCSKIFPQKDSVSWSKKTVSNGSKTHCMKTWNPINNRKFE
TLSYLPPISDESIAKEIDYMIKKGWIPCLEFDEVGCVHRENSRMPNYYDGRYWTLWKLPM
FGCNDSSQVLNEIHECKKEYPNAYIRCLAFNNVKQAQCMAFLIQKPNTA
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctactggtttctcagctgtggttgctggatcaacctatgcaggtttgacatcc
aattgctctaagattttccctcagaaggactcagtttcttggagcaagaaaactgtttca
aatggctctaaaactcactgcatgaagacttggaaccccatcaacaacaggaagttcgag
accctttcatatcttccacctatctccgatgaatcgattgcaaaggagattgactacatg
atcaaaaagggatggatcccttgtcttgaattcgacgaggtgggatgtgtgcacagagaa
aacagcaggatgccaaattactatgatgggagatactggactctgtggaagctgcccatg
tttggctgcaatgactcctctcaagttctgaatgaaattcatgagtgcaaaaaggaatac
cccaatgcttatattcgctgtttggcatttaacaacgtcaaacaggcacagtgcatggca
tttctcatccagaagccaaacaccgcctaa

DBGET integrated database retrieval system