KEGG   Oceanobacillus iheyensis: OB2339Help
Entry
OB2339            CDS       T00093                                 

Definition
(GenBank) superoxide dismutase (Cu-Zn)
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
oih  Oceanobacillus iheyensis
Brite
Enzymes [BR:oih01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     OB2339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: BAC14295
JAMSTEC: OB2339
UniProt: Q8ENY5
LinkDB All DBs
Position
complement(2396079..2396666)
Genome map
AA seq 195 aa AA seqDB search
MRPLILGLIMSLTLLLSACLLHNPKSLTIEMYNVDGDRVGTALLSDQEDAVAIELDLEGL
QPGFHAIHVHEYGRCEAPDFTTAGNHLNPQGKEHGMIHPEGSHLGDLPNIEADAGGLVHA
ELELSGASLQEGKSSLINNDGTALIVHEGQDDGMSQPGGDSGTRIVCGEIHAEKESGDSE
KAPTDPTEQNDEQEE
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcctctaatattaggattaataatgagccttacattgttattatctgcgtgtttg
cttcataatccgaaatcactaacaatagaaatgtataatgtagatggtgatcgagtaggg
acagccttattaagtgatcaagaagatgctgtagccattgaattggatttagaagggctt
caaccaggatttcatgctatacatgttcatgaatatggaagatgtgaagctcctgatttt
actactgctggtaatcatctgaatccccaaggtaaggaacatggaatgatacatcccgaa
ggatctcatttaggagatttaccaaatatcgaagcagatgcaggcggtttagtacatgcc
gaacttgagctctcgggagcttcgttacaagaaggaaaaagttcattaataaataatgat
gggaccgcattaattgtccatgaaggtcaagatgatggaatgagtcaaccaggtggagat
tctggaacaagaatcgtttgtggagaaattcatgcagaaaaggaatcaggagattcagaa
aaagcaccgactgatccaaccgagcaaaatgatgaacaggaagaataa

DBGET integrated database retrieval system