KEGG   Oceanobacillus iheyensis: OB2840Help
Entry
OB2840            CDS       T00093                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
oih  Oceanobacillus iheyensis
Pathway
oih00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:oih00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    OB2840
Enzymes [BR:oih01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     OB2840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC Tnp_DNA_bind
Motif
Other DBs
NCBI-ProteinID: BAC14796
JAMSTEC: OB2840
UniProt: Q8EMK2
LinkDB All DBs
Position
complement(2923357..2924817)
Genome map
AA seq 486 aa AA seqDB search
MLKTDKQSYLNFINGRWKSSEGGETKEVLNPADKNDVVGVIQRSTIDDVNEAIASAKSAK
ESWRKLSGNERGNYLYKVANILESRLDDVAETLTREMGKTLPEAKGETARGVAILRYYAG
EGLREVGDVIPSTDSSGIMYTTRTPLGVVGVITPWNFPVAIPIWKMAPALIYGNTVVIKP
ATEAAATAAKVMECFADAELPDGVVNMVTGSGSIVGNRIAEHPDVNGVTFTGSDQTGKHI
GQTALARGAKYQLEMGGKNPVIVADDADLDLAVKATISGGLSSTGQKCTATSRVIVQRSV
YDAFKEKLLTQIQALTVGNGLEDGNWMGPSVSESQLETVLHYIKKGKEEGATLLTGGHRL
TDAEHKDGNFVEPTVFEDVTNDMTIAQEEIFGPVLALIKVETFEEAMKLANDTEYGLSAA
VFTENIRKMLTFIDDIEVGLVRVNAETAGVELQAPFGGMKSSSSHSREQGKAAIEFFTSI
KTVFIK
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaacagataaacagtcatacttgaatttcataaatgggagatggaagtcttct
gaaggtggagaaacgaaggaagttctaaatcctgcagataaaaatgatgttgtaggagtt
attcaacggtcgactatcgatgatgtaaatgaggctattgcatctgcaaagtcagcaaaa
gaaagttggaggaaactatctggaaatgaaagaggaaactatctttataaggttgctaat
attttagaaagtcgtctggacgatgtagcagaaaccttaaccagagaaatgggaaaaaca
ttaccggaagctaaaggtgaaacggctagaggcgtagctatccttcgttactatgcagga
gaaggattaagagaagtcggggatgtcattccttctacagatagtagtgggattatgtat
acgacacgaactcctttaggtgtagttggagtaattacaccatggaatttcccagttgct
attccaatttggaaaatggctcctgctctcatttatggaaatacagtggtaatcaagcca
gcaacagaggcagcagctacggcagctaaagtcatggaatgttttgctgatgcagagctt
cctgatggagttgtcaatatggtgactggttcaggatcgattgttggaaatagaattgca
gagcatccggatgtaaacggagttacctttactggctcagaccaaactggaaaacatatt
ggacagactgctttagctagaggagcaaaatatcagcttgaaatgggtggaaagaaccca
gttattgtggcagacgatgccgatctagatttagctgttaaggctactatcagtggtggt
ttaagttccactggtcaaaagtgtacggcaacaagtcgtgtaatcgttcaacgttcggta
tatgatgcctttaaagaaaaattactaacgcaaatacaagctttaacggttggtaatggt
ttagaagatggaaattggatggggccaagtgtaagcgaatcacaactggaaacagtactt
cactatattaaaaaaggaaaagaagaaggggctactttattaactggtgggcatcgtcta
acagatgctgagcacaaggatggtaactttgttgaaccaactgtgtttgaagatgttacg
aatgatatgacaatagctcaagaagaaatcttcggcccagtgcttgctctcattaaagta
gaaacatttgaagaagcgatgaaattagctaatgatacagaatatggtttaagtgctgct
gttttcacggaaaatattagaaaaatgttaacatttatcgatgacattgaggtaggctta
gtcagagtgaatgcagaaacagcgggtgtagaattacaagcaccattcggcggaatgaaa
agctctagttctcactcaagagaacaaggtaaagcagcgatagaatttttcacttcgatt
aagacagtatttattaagtag

DBGET integrated database retrieval system