KEGG   Oryzias latipes (Japanese medaka): 101155408Help
Entry
101155408         CDS       T02443                                 

Gene name
suv39h1
Definition
(RefSeq) histone-lysine N-methyltransferase SUV39H1 isoform X1
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101155408 (suv39h1)
Enzymes [BR:ola01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101155408 (suv39h1)
Chromosome [BR:ola03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101155408 (suv39h1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101155408 (suv39h1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 412 aa AA seqDB search
MADNSTGCSVPCKMTYGELEALCRTETLHCKELGVSRANVNEYEVEFLCNYKKTKEEEEF
YLVKWKGFPESDNTWEPKRNLKCSKLIKQFHLDLDLVLKSQKRRAIPKKLDKEVALFLIQ
KAKLRQSLQRWQDHLNDTRNHPGRIFVTNDVDLEGPPKNFTYINNYKVGPGIVLNEMAVG
CDCKNCLEDPVNGCCPGASLHRMAYNDRGQVRIRPGKPIYECNSRCSCGPDCPNRVVQKG
IQFDLCIFKTEDGRGWGVRTLQGIKKNTFVMEYVGEIITTDEAEKRGHLYDRQGSTYLFD
LDYVEDVYTVDAAHQGNISHFVNHSCNPNLQVFNVFIDNIDERLPRIALFSTRSIRAGEE
LTFDYKMQIDPVDTESTKMDSSFSLAGLPGSPKKRVRVECRCGSELCRKYLF
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcggacaattcgacaggatgcagcgtgccttgtaagatgacgtatggcgagctggaa
gccttgtgtcgcactgagaccctgcactgcaaagagctcggagtgagcagagcgaatgtc
aacgagtatgaggtggagtttctctgcaactacaagaagactaaggaggaagaggagttc
tacttggtgaagtggaagggcttccctgagtctgacaacacctgggaacccaagaggaac
ctcaaatgctcaaagctgataaagcagttccacctggacctggacctggtgctcaagagt
caaaagaggcgtgccatacccaaaaagttagataaagaggtcgccttgttcctcattcag
aaagccaaactccgtcagagtctccagcgctggcaggaccatctgaatgacactcgcaac
caccccggtcgcatttttgtcacaaatgatgtggacctagagggccctccaaagaacttc
acctacattaacaactacaaagtcggccctggcattgtgttgaatgagatggctgtaggt
tgtgactgtaaaaactgcctggaagatccagtgaacggctgttgtccaggagcctccctg
caccgcatggcctacaacgatcgcggccaggtccggatcaggccaggaaagcccatttat
gaatgtaactcccggtgcagctgcggacctgactgtcccaacagagtggtccagaagggc
attcagtttgacctgtgcatctttaagaccgaggacggccggggatggggcgtgcgcacg
ctgcagggcatcaagaagaacacctttgttatggagtatgttggagagataattacaaca
gatgaagcagagaagaggggccatttatacgaccgccagggctccacctacctgtttgac
ctcgactatgtagaagatgtgtacacagtggatgctgctcaccaaggaaatatctcccac
tttgtcaaccacagttgtaaccctaacctgcaggtcttcaatgtgttcattgacaacatt
gatgagaggctccccagaatcgctctgttctcaacgcgatctatccgggcaggggaggag
cttaccttcgactacaagatgcaaattgatccagtggacacagagagcaccaaaatggac
tccagtttcagcctggctgggctccccggctcgccaaagaagagggtccgggttgagtgt
cggtgtggctccgaactctgtcggaagtacctcttctga

DBGET integrated database retrieval system