KEGG   Oryzias latipes (Japanese medaka): 101158302Help
Entry
101158302         CDS       T02443                                 

Gene name
setdb1
Definition
(RefSeq) histone-lysine N-methyltransferase SETDB1 isoform X1
  KO
K11421  
histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101158302 (setdb1)
Enzymes [BR:ola01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101158302 (setdb1)
Chromosome [BR:ola03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101158302 (setdb1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101158302 (setdb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
16
AA seq 1238 aa AA seqDB search
MENVEGMEVDGWDSSLEEEFGISLDELKKWIDEAVEKSDIVQKKKAQLTELKEWVEQKEE
EEAKTEMLLTDANQSVIECEKLVKEACKKNGLVYRESGSEDEGGGGGSLPSEVIEIDDDD
DDDVIAVGCLVPPNKTLTPSKDPALKEASAVLQKTSHQVQKLVQIVAKSPASAALLRSPT
QLSAPSGIQSSAPAVFVSQAPSQGMTQPSPNIKEDELKIGMNILGKKRTKTWHRGTLVAI
NPIGGGVYKYKVKFDKGKSLLSGNHVAFDYNPTLESLFVGARVVAKYKDGNLVWLYAGIV
AEMPNNKNRMRFLIFFDDGYASYVILPELYPVCRPLKHTWEDIEDASCRDFIEEYISAYP
SRPMVLLKAGQIIKTEWEGTWWKSRVEEVDGSLVKILFLDDKRSEWIYRGSTRLEPMFNL
KMTTANTHEKKLAGQQRTRPNMGALRTKGPVVQYTGVEHVGGSPVKSPQPPSTEPVTPQP
QPSPQPQQPQPIAQNTQPPQPPQPPRVENKTQMAKKSTSPFVPGVGGTHASKILQSLTPT
STNIASAKILSPAVTPQSNFSSLYPRPLPTTPPAPPPMPHVVATIPTQASYRAPTDRIFY
LAHTCQPACLNRVRPVKPDIHRGKNPLLTPLLYDFRRMTGRRKVNRKMSFHVIYKAPCGL
CLRNMPEIQNYLFQTRCDFIFLEMFCLDPYVLVDRPFQPQRPFYYIPDITGGKEDIPLSC
VNEIDNTPPPKVKYSKERIPEDGVFINTSDDFLVGCDCTDGCRDKSKCSCHQLTLQATAC
TPGAQINPNAGYLHKRLEECLPTGIYECNKRCKCCAQMCTNRLVQHGLQVRLQLFKTQNK
GWGIRCLDDVAKGSFVCIYAGKILTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESE
AHCSDSEGSGVDLSRMKIQPSALVSSSSGGRHPRKARNSSSTTDSNDDEDKDSKSEDESD
SSDDTFVKENFYTSSSVWRSYTTRGQLKGNKEGSQDSKDGLSLTCREKGDDNPPAMPEET
GKSKVAFWLTSQGLKKDTGDGKSQAKSEPGKKQDVMTLSDSDDVQTISSGSEDNKEKEKV
PTGVPKKQVAVKSTRGIALKNSHSMMVKTGSGGGGGGGGAGGQGGKAGTSGQTTGGGENA
PKNTRLFFDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASK
RIRAGTELTWDYNYEVGSVEGKELLCCCGSTECRGRLL
NT seq 3717 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacgttgaaggaatggaggtggatggctgggactccagtctggaggaagagttt
ggcatatccctggatgagctgaagaaatggattgatgaagctgtggaaaagagcgacatt
gtccagaagaagaaagctcagctgacggagcttaaggaatgggtggagcagaaagaggaa
gaggaggcaaagacggagatgctgcttactgatgccaaccagtctgtaatagagtgtgag
aagctggtgaaggaagcttgtaagaagaatggtcttgtttatcgtgagagcggctccgag
gatgagggaggcggaggaggttccctgccctctgaagttatagagatagacgacgatgat
gacgacgacgttattgctgttggttgtttggttcccccaaacaagacattaaccccctct
aaagaccctgcgttaaaggaagcctctgcagttctgcagaaaacctcccaccaagttcag
aagttggtccaaatagtcgccaagtctccagcatctgctgcgttgcttcgatctccaaca
cagctctctgctccttcaggtattcaaagctcggcaccagcagtgtttgtgtctcaggcc
ccatcccaaggaatgactcagccgagcccaaacataaaagaagatgagctcaaaattggg
atgaacattctgggaaagaaacgcacgaagacctggcacagaggcactcttgttgccatc
aaccctattggaggtggggtttacaaatacaaagtaaagtttgataaaggcaagagtctg
ctgtcgggaaaccatgtggctttcgactacaaccccactctggagagtctgtttgttggg
gctcgagtagttgccaagtacaaagatggcaacctggtgtggctgtatgcaggaatcgta
gcagaaatgcccaacaacaagaaccgcatgaggttcttgatcttcttcgatgatggctat
gcttcctatgtgatacttcctgaactttaccctgtttgcagacctttaaaacacacttgg
gaggacatagaagatgcttcttgtcgagactttatcgaggagtatatctctgcctatccc
agcaggccgatggtgctcctcaaggccggccaaataatcaagacggagtgggaaggaact
tggtggaagagcagggtggaggaagtggatggcagcttggtcaagattctctttttagat
gataagaggagtgagtggatctacagaggatccaccaggctggagcctatgttcaacctg
aaaatgaccacagctaacacccatgaaaagaagctggctgggcagcagaggacgagaccc
aacatgggagctttgcggactaaaggcccggtagttcagtacacaggggtggaacatgtt
ggaggttctcctgttaaaagcccacagcccccatctactgaacctgtgaccccacagcct
caaccaagtccacaaccacagcaacctcaaccgattgcacagaacactcagcccccacag
cccccccagcctccacgtgtggagaataaaactcagatggcaaagaagagtacgtctcca
tttgtgcctggagttggaggcacacacgcttccaaaatcctgcagtctttgacccccact
tccactaatattgcaagtgcaaaaattctgagtcctgcagttactcctcagtccaatttt
tcctcgttgtatccgagaccgcttcccaccacacctcctgccccccctcccatgccgcat
gtggtggccaccattcccacacaggcctcgtacagagccccaacagaccgcatcttttac
ctggcccatacgtgtcagcctgcctgtctgaaccgggtccgaccagtaaaaccagacatc
cacagaggcaagaaccccctcctcacacctttgctgtatgatttcagacgcatgacagga
cgccgtaaagtcaatcggaagatgtctttccacgtgatctacaaggctccatgtggactt
tgtctgcgcaacatgccagagattcagaactacctcttccagacccgctgtgactttatc
ttcttggagatgttctgcctcgatccctatgtgctggtggaccgccctttccagccgcag
aggcccttttattacattccagatatcactggtgggaaggaggacatccctctttcatgc
gtgaacgagatcgataacactccgcctcctaaagtcaaatacagtaaagagcgtattcca
gaagatggagtattcatcaacaccagcgatgacttcctagttgggtgcgattgcaccgat
ggctgtcgagacaagtccaaatgttcctgccaccagctgactcttcaagccacagcttgc
acaccaggggcgcagatcaacccaaacgctggatatttgcacaagcgattagaggagtgt
ctgcctacagggatctacgagtgtaataagaggtgcaaatgttgtgctcagatgtgcacc
aacaggctggtgcagcacggcctgcaggttcgtcttcaactcttcaaaacgcagaacaaa
ggctggggcatccggtgtctggatgatgtggccaaaggctcattcgtctgcatttatgct
ggtaaaatcctgacggacgattttgccgacaaagaaggtctggaaatgggcgatgagtat
ttcgccaacctagaccacattgagagcgtggagaacttcaaggagggctacgagagcgag
gcccactgctcagacagcgagggaagtggcgttgacctttccaggatgaaaatccagcca
tccgcgttagtgtcgagtagcagcggggggcgacatcccaggaaggctcgcaactcaagc
tcaaccactgatagcaatgatgacgaggacaaagattcaaagagtgaagacgaaagtgac
agttcagatgacacttttgtcaaagaaaacttctacacttccagttccgtgtggaggagc
tacacaacacgcggccagctgaaaggcaacaaagaagggagtcaggacagtaaagatgga
ttgagcctcacatgcagagagaaaggtgatgataaccccccagccatgcctgaggagacg
ggcaaaagcaaagtagctttttggctaacgagccaggggctcaagaaggacaccggagat
ggcaagagtcaagcaaaatcagaaccaggaaagaagcaggatgtgatgactctctcagac
agtgatgatgtccaaaccatcagctctggatcagaagacaacaaagagaaggagaaagtt
cctacaggtgtgccaaagaagcaggtggcagtaaagtccactcgaggcatcgccttgaaa
aacagccacagtatgatggtaaaaaccggttcaggcggaggaggaggaggaggaggagca
ggaggccagggggggaaagctgggacgtcaggacaaaccacaggaggcggagaaaatgct
cccaaaaacactcggctgttcttcgatggcgaagagtcctgctacatcattgatgccaag
ttagaaggaaatctcggacgttatctgaaccatagctgcagtccaaacctatttgtccag
aatgtgtttgtggacactcatgacttgcggttcccctgggtggctttctttgccagcaaa
cgaatccgggccggtaccgagctgacatgggactacaactatgaagtgggcagcgtggag
ggaaaagagctgctctgctgctgcggctccacagaatgcagaggaagattgctgtga

DBGET integrated database retrieval system