KEGG   Oryzias latipes (Japanese medaka): 101159547Help
Entry
101159547         CDS       T02443                                 

Definition
(RefSeq) histone deacetylase 1 isoform X1
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Cell cycle
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    101159547
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    101159547
Enzymes [BR:ola01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101159547
Chromosome [BR:ola03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     101159547
   HDAC complexes
    Sin3A-HDAC complex
     101159547
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101159547
  Chromatin remodeling factors
   NuRD complex
    101159547
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
22
AA seq 476 aa AA seqDB search
MALTSQGTKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
SGEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVA
GAVKLNKQQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEA
IFKPIMAKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTIKGHAKCVEYIKSFNLPLLMLG
GGGYTIRNVARCWTYETAVALDSSIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNDYL
EKIKQRLFENLRMLPHAPGVQMQPIPEDAVQEDSGDEDEEDPNKRISIRAHDKRIACEEE
FSDSEDEGEGGRRNIAGFKKAKRVKTEGEKEGEEKEKKEVKEEEKVPEEEKMETSK
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttacttctcaaggaacaaagaaaaaagtttgttactactacgacggtgatgtt
ggaaactattattacggacagggtcatcccatgaaaccccatcggatccgaatgacccac
aacctgctgctgaactatggtctctacagaaaaatggagatatatcgtcctcacaaagct
agtggagaggagatgaccaagtaccacagcgacgactacattaagttcctgcgctcgatc
cgacctgacaacatgtcggaatacagcaaacagatgcagagatttaatgtgggggaggac
tgccccgtctttgatggtttgtttgagttctgtcagctctctgcaggaggctctgtcgct
ggtgctgtgaaattgaacaaacagcagacggacattgccatcaactgggctggaggcctg
catcacgccaagaagtcagaggcctctgggttttgctatgtaaatgacatcgtgctagct
attctggagttgttgaaataccaccagagagttctgtacatagatattgacatccatcat
ggagacggagtggaggaagcgttctacaccacagatcgtgtcatgacggtgtccttccac
aaatatggagagtacttcccaggcactggggacctcagggacatcggtgctggtaagggt
aaatactatgctgtaaattatccgctgagggatgggattgatgatgagtcctatgaagca
atattcaaacccatcatggccaaggtgatggagatgtaccagccgagtgcagtggtcctc
cagtgtggagccgactctctgtctggggacagactgggttgttttaacctcactattaaa
ggtcacgccaagtgtgtggagtacataaagagcttcaacctgccgctgttgatgctgggt
ggaggaggctacaccatccgtaatgtggcgcgctgctggacgtacgagaccgctgtggcc
ctcgatagctccatccctaatgagcttccatacaacgactactttgagtactttggacca
gacttcaagctgcacatcagcccctccaacatgaccaatcagaacaccaacgactacctg
gagaagataaagcagcggctgttcgagaacctgcggatgttgcctcacgcccctggagtt
cagatgcagcccatccccgaggacgccgtgcaggaggacagcggggatgaggacgaggag
gatccgaacaagcgcatatccatccgcgctcacgacaagaggatagcatgcgaagaggag
ttctccgactctgaggacgaaggagagggaggccgcagaaacatagcaggcttcaaaaaa
gccaagagagtaaaaacagaaggagagaaagagggagaagaaaaggagaagaaagaagtg
aaagaagaggagaaagtgccggaagaggagaaaatggagacatcaaagtga

DBGET integrated database retrieval system