KEGG   Oryzias latipes (Japanese medaka): 101164425Help
Entry
101164425         CDS       T02443                                 

Gene name
cdc23
Definition
(RefSeq) cell division cycle protein 23 homolog
  KO
K03355  
anaphase-promoting complex subunit 8
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:ola00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101164425 (cdc23)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    101164425 (cdc23)
   04114 Oocyte meiosis
    101164425 (cdc23)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    101164425 (cdc23)
Ubiquitin system [BR:ola04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     101164425 (cdc23)
Chromosome [BR:ola03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    101164425 (cdc23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
14
AA seq 573 aa AA seqDB search
MAALCAEFGDLVQIKKQLISVISLCKDRGLLHSAKWASELAFALDPLPKDELPSPPPFTE
EDARDLDAVTLAKSYFDLKEYDRAAYFLRACCSQKAYFLYMYSRYLSGEKKKDDETVDSL
GPLEKGQVRNEALRELRVELSKKHSAGELDGFALYLYGVVLRKLDLLKEAVDVLVEALHA
LPLHWGAWLELSNLVTNIDMLKSLSLPDCWVKDFFMAQMYTELQMIKEALQKYHSLIQAG
FSKSTYIISQIAVAYHNIRDIDQALALFNELREQDPCRIDNMDTFSNLLYVKGMKPELSY
LAHNLVEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRCLGAWTLMGHEYMEM
KNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRKAHQLRPNDSRMLVA
LGESYEKLSQQGEAKKCYWRAYSVGDVEKMALLKLAKLHEQLNESDDAARCYMFYIQDIF
SCAEQLEHAEVSTALRYLGQYYFKNKLYDEASLCAQRCCDYNDAREEGKALLRQISQVRD
QTETPSADLFAPLSNNNTPVRRVSPLNLISFTP
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggcggctctgtgtgcagagtttggggacctggttcagataaaaaagcagctcatatct
gtaatttctctttgcaaagacaggggacttttgcacagcgccaagtgggcttctgaactg
gcgtttgctttggaccctcttcccaaagatgagctgccctcaccacctccattcacagag
gaggatgctcgagacctggatgcagtcactttggccaagtcctactttgacctgaaagag
tacgaccgtgctgcttactttctgagagcctgctgtagtcagaaagcttacttcctctac
atgtattctcgttatttgtcaggtgagaaaaagaaagatgatgagaccgtggatagcctg
ggtcctttggagaagggtcaggtgcgcaatgaagctctgcgagaactgagagttgagctc
agcaagaagcactcagcaggagagctggatggctttgccctctatctgtatggagttgtt
ctacgaaaacttgatctccttaaggaggcggtggacgtcttagtggaggcacttcatgct
cttcctcttcactggggcgcatggctagagctcagtaacctcgtcaccaatattgacatg
ctgaagtctctgtctctgcccgactgctgggttaaagacttcttcatggcccaaatgtac
acagagctgcagatgatcaaagaggcgctgcagaaatatcatagcctcatccaggctggc
ttttccaagagcacctacattatctcacagattgccgtggcctaccacaacattagagat
atcgatcaagctttggctttgttcaatgagctgagagagcaggatccgtgtcgcatcgac
aacatggacacgttctccaacctgctgtatgtcaagggtatgaaaccagagttgagttat
ctggcccacaacctggtggagatcgacaaatacagagtggagacttgttgtgttattggt
aactactacagcttacgctcccagcacgagaaggcagcgctgtacttccagcgggctctc
aagctgaaccctcgatgtctcggagcttggaccctgatgggccacgagtacatggagatg
aagaacacgtcagcagccatccaagcatacaggcatgccatagaagtgaataagcgtgat
tacagggcctggtatggcctgggacagacttacgagattctcaagatgcccttttattgt
ttgtactattatcgaaaggctcatcagctcagaccaaatgactcacgcatgttggtggca
ttgggtgaaagctatgaaaaactgtcacagcaaggtgaagccaaaaagtgctactggagg
gcatactctgttggcgatgtagaaaaaatggctctgctcaaactagctaagctccacgag
cagctgaacgagtcggatgatgctgctcgatgttacatgttttacattcaggacattttt
tcttgtgcggaacaactggagcacgcagaagtaagcacagccctgcgctacctgggtcag
tactatttcaagaacaagttgtatgacgaggcgtccctctgcgctcaacgctgctgtgac
tacaatgatgctcgcgaagaaggaaaggctctgttgaggcagatctcacaggtgagggat
cagacagagacgccgtctgcagatctcttcgctccgctgtcaaacaacaacacaccagtg
aggagggtgtctcctctcaacctgatctcctttactccctaa

DBGET integrated database retrieval system