KEGG   Oryzias latipes (Japanese medaka): 101165180Help
Entry
101165180         CDS       T02443                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase K-like
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101165180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
17
AA seq 786 aa AA seqDB search
MPGERLTVRGASEVGRFPGAAPPTRVEVSIQRQEKKREDGGCRRWFRKICPCCCKRQNSS
SYDVTDKVELKVPSPTPPPVISPEPTKPKPENGEAKEMEEIKLKVCSVDLLSSRTGQNRK
EHHTDLYHGDELIIRRGQTFQMEMELNRPYDPDTDKILLELKTGPLPLVSKGTHIIIPLV
DHLEDGRWEAKITDQSDNKIKLSVNSPANAVVGLYGFTVTSRHVKNETANTHNPDKNIVI
LFNPWCEEDTVFLDDEEQRKEYVLNDTGRIYYGTEKQIGARTWNFGQFHEGILEACFFIL
EKSDMPPSGRRDPINVVRVISAMINIQDDFGVLVGNWSGNYSDGVSPNAWTSSIEILRKY
HSTGGEPVKYGQCWVFSAVTTTVLRCLGIPTRSVTNFQSAHDTDVSLTTDVYYDENMEPI
DELNSDSVWNFHVWNDCWMARPDLPPGYGGWQAVDSTPQETSQGTFRCGPASLIAIRSGH
VYLKHDVPFVFAEVNSDKIHWQRNLDGTFSQVHIEKKAVGHCISTKAVGSDDREDITYLY
KHPEGSEEERIAVETASRYGSKPEVYSAPIAEDVCVEVKMDGEGPRIGSDAQLSIVVKNM
SSQPRRATLHSQAAIMYYTGVLKNAIKKDQILVELLPNEEKSIEWVLPYQQYQDQLVDQA
ALMMTLSGRVTETKQVLANQMTFRLRTPDLKLTPLGEAVVGKEMSAKITFTNPLPRTLKG
VLFRVEGLGLQKGHEVVVGDVGGHSTVTLTEHFIPTQPGTRKLVASLDCKQLSQVHGVAD
IVVLEK
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgccaggcgagcggttaacagtcagaggggcctctgaagtcgggcgttttccaggtgct
gccccgcccaccagggtggaggtttccattcagaggcaggaaaagaagcgggaagatgga
ggttgccgccgctggttcaggaagatctgcccgtgctgctgcaagcgtcagaacagttct
tcctatgacgtcacagacaaagtggagctgaaagtcccaagccccaccccacctcccgtt
atcagccccgagcccaccaaacccaaacctgagaatggagaagcaaaggaaatggaagaa
ataaagctgaaggtgtgctcagtggaccttctcagctccagaactggtcagaacagaaag
gagcatcataccgacttgtaccacggcgatgagttgatcatccgcagaggacagaccttc
cagatggagatggagcttaaccgtccgtatgacccagacaccgataagatactcctggag
ctaaaaacagggccgctgcctttggtgtccaaaggaacccacatcatcatccccttggtg
gaccacctggaggacggacggtgggaggccaagattaccgatcaaagcgacaacaagatc
aagctgtccgtgaactctccagccaacgccgtcgtgggcctgtacggcttcaccgtcacc
agtcgccatgtgaaaaatgaaacggccaacactcacaatccggacaagaacatcgtcata
ctcttcaacccttggtgtgaagaggacacggtgttcctggacgatgaggagcagaggaag
gagtatgtgctgaacgacaccggcagaatttactacggcacagagaaacaaatcggcgct
cgcacatggaacttcggacagtttcatgaaggcattctggaagcgtgcttcttcatcctg
gaaaagagtgacatgcccccgtctggtcgccgagatcccatcaacgtggtccgagtcata
tcggccatgataaacatccaggacgacttcggcgttctggtggggaattggtcagggaat
tactctgacggcgtctctcctaacgcgtggaccagcagtatagagatcctaaggaaatac
cactcgaccggtggggagccggtgaaatatggacagtgctgggtcttctctgcggtcacc
acaacagtcctccgctgtttgggaatccccacccgcagtgtgaccaacttccagtctgca
cacgacacggacgtgtctctcaccacagacgtgtattacgatgaaaacatggagccgatt
gacgagctcaatagtgactctgtctggaacttccatgtgtggaatgactgctggatggcc
agaccagacctgcctcctggttatggaggctggcaggctgttgactccaccccccaggag
acgagccagggcaccttccgctgtggccccgcctccctaattgccatccgctccggtcac
gtttatctaaaacacgacgtgccttttgtcttcgctgaggtcaacagtgataaaatccac
tggcagaggaacctggacggtactttcagtcaggtccacattgagaaaaaagctgtgggc
cactgcatcagcaccaaagcagtgggctcagatgatcgggaagacatcacatacctgtac
aagcacccagaaggttcagaggaggagcgcatcgccgtggagacggccagtcgctatggc
agcaagccagaggtgtactctgcgcccatagcagaagatgtatgtgtggaagtgaagatg
gatggcgaggggccccgcattggatccgatgcccagctgagcatcgtggtgaagaacatg
agctcgcagccccgccgggcgactctgcacagccaggctgccatcatgtactacaccggt
gtgctgaagaacgctataaagaaggatcagatactagtggagcttttgcccaatgaagaa
aagagcattgagtgggttctgccgtaccagcagtaccaggaccagctggtggatcaggcg
gctctgatgatgaccctttcaggaagggtcaccgaaacgaagcaagtgctggccaaccag
atgactttcaggctgcgtacacctgacctcaaattaacccctctaggagaagccgtggtt
ggtaaagagatgtcagccaagatcaccttcaccaacccgctgccgcgcacgctgaaggga
gtgctgttcagagtggagggcctgggacttcagaagggtcacgaagtggttgtcggggat
gttggcggtcactcgaccgtgaccctgaccgaacacttcatccccacccaacccggaacc
aggaagctggtggcgtctcttgactgtaaacagctctcacaagtgcacggagtggcggac
attgttgtccttgaaaaatga

DBGET integrated database retrieval system