KEGG   Oryzias latipes (Japanese medaka): 101170534Help
Entry
101170534         CDS       T02443                                 

Gene name
sod1
Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ola00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    101170534 (sod1)
Enzymes [BR:ola01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     101170534 (sod1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 101170534
NCBI-ProteinID: XP_004076261
UniProt: H2LHN5
LinkDB All DBs
Position
14
AA seq 154 aa AA seqDB search
MVLKAVCVLKGTGETNGVVNFEQESDSAPVKVTGEIKGLTPGKHGFHIHVYGDNTNGCVS
AGPHFNPYNKNHGGPEDAERHVGDLGNVTAGDNNVAKIDITDKLIRLSGPDSIVGRTVVV
HEKVDDLGKGGNDESLKTGNAGARLACGVIGIAQ
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgaaagcagtttgtgtgttgaaaggaacaggagaaaccaacggcgtggttaat
tttgaacaggagagcgattcagcccctgtgaaggtgactggagaaatcaaaggcctcaca
ccaggcaagcacggcttccacatccacgtgtatggagataacaccaatgggtgcgtcagt
gcagggcctcacttcaacccatacaacaagaaccacgggggtcctgaagatgcagaaaga
cacgttggggacctgggaaatgtgaccgcaggagataataacgttgctaaaatagatatc
acggacaaacttatcagactctcaggtccagactctattgttggcagaactgtggtggtc
catgagaaagttgatgatcttggaaaaggtggaaatgatgaaagccttaaaactggaaat
gctggagcgcgtttggcctgcggcgtgatcggcatcgctcagtaa

DBGET integrated database retrieval system