KEGG   Oryzias latipes (Japanese medaka): 101173780Help
Entry
101173780         CDS       T02443                                 

Gene name
hdac11
Definition
(RefSeq) histone deacetylase 11
  KO
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101173780 (hdac11)
Chromosome [BR:ola03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class IV HDACs
     101173780 (hdac11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
5
AA seq 366 aa AA seqDB search
MSLKEDTRKTSSHPTNLYTSLPQTCLPIVYHPDYNITFMGLEKLHPFDAGKWGKVIHFLK
EECFLTDADIVEAREATEEDLLVVHTKHYLKRLKWSVVVATITEIPPLLFLPNFLVQRKV
LRPLRTQTGGTIMAGKLAVDRGWAINVGGGFHHCSSNKGGGFCAYADITLAIKFLFERVE
GISKATIIDLDAHQGNGHERDFLEDRRVYIMDVYNSHIYPGDGHAKRAIRRKVELDWGTE
DSEYLQKVELHCEGALNELRPDIIVYNAGTDILDGDPLGGLSISPQGIVKRDEIVFRAAK
QRGIPILMVTSGGYQKRTARIIADSILNLRQQGLIRGGAGQSEGLPLRATHMESSSGSAG
STSTRE
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgaaagaagatacaagaaaaacgagctctcacccaaccaatctgtatactagc
ctccctcagacatgcctacccatcgtgtaccacccagactacaacatcaccttcatgggc
ttggagaagctgcacccctttgatgcaggaaaatggggaaaagtcatccactttctaaaa
gaggaatgctttctcactgatgctgacatcgtggaagcccgtgaagccacggaggaggat
ctgctggtggttcacaccaaacactatctgaaaaggttaaagtggtcggtcgtcgtggca
accatcacagaaatccctccgctcttgtttctgccgaatttcctggtgcagcgaaaggtg
ctgaggcctttacggacgcaaacaggaggaaccatcatggctggaaaactggctgttgac
cgaggatgggccatcaacgttggtgggggcttccatcactgctccagtaacaagggtgga
ggcttttgcgcctatgcggacatcactctggccatcaagtttctgtttgagagagtggaa
ggcatctccaaggccaccatcatcgatttagatgctcatcagggaaacggtcatgagcgc
gacttcttggaggacaggcgggtctacatcatggacgtgtataattcccacatctatcct
ggggacggacacgccaagcgagccataaggagaaaggtggagctggactggggaaccgaa
gactctgagtaccttcagaaggtggagcttcactgcgagggtgcactgaatgagctccgc
cctgacatcatcgtctacaatgcaggaacggacatcctggatggagaccccctcggaggg
ctatccatatcacctcagggcattgtgaagcgggacgagatcgtgtttagggctgcaaag
cagcgaggcatccccatactgatggtgacatctggaggataccagaaaagaacggcaagg
atcatcgctgactccatcctgaacctgaggcagcagggcctgatcagaggcggagctgga
cagagcgaggggcttcctctgagggcgacccacatggagagcagctctgggtcagctggg
tccacttccacgcgagaatga

DBGET integrated database retrieval system